SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007126 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007126
Domain Number 1 Region: 95-368
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-73
Family Protein kinases, catalytic subunit 0.0000000036
Further Details:      
 
Domain Number 2 Region: 363-419
Classification Level Classification E-value
Superfamily SH3-domain 0.00000107
Family SH3-domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007126
Domain Number - Region: 911-948
Classification Level Classification E-value
Superfamily UBA-like 0.00714
Family TAP-C domain-like 0.077
Further Details:      
 
Domain Number - Region: 7-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0197
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 
Domain Number - Region: 949-988
Classification Level Classification E-value
Superfamily UBA-like 0.051
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007126   Gene: ENSGACG00000005390   Transcript: ENSGACT00000007144
Sequence length 993
Comment pep:known_by_projection group:BROADS1:groupXXI:11237538:11244007:-1 gene:ENSGACG00000005390 transcript:ENSGACT00000007144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQCEEGTEWLLELLTDVQLQQYFLRVRDELNVTRLSHFDYVKNEDLEKIGMGRPGQRRLW
EAVKRRRALYKRKSWMSKVFPVKRPDADPQSLTCLIRESELQLLERLGDGTFGVVRRGEW
TGPNGRVLSVAVKCLKAGVLDSDGLDDFIREVNAMHSLSHQNLIRLYGIVLTQPMKMVVT
ELAPLGSLLDRLRKRQGHILISSLCNYAVQVACGMAYLEQRRFLHRDLAARNVLLSTNET
VKIGDFGLMRALPTHTDQYVMEEGHKIPFPWCAPESLKSRTFSHSSDTWMFGVTLWEMFT
HGQEPWPGLNGSQILHKVEVDAERLCKPDDCPLDVYNVMLQCWSPKPEDRPTFVALRDFL
LETMPTDMKALQDFEEEDKLQIKMNDVITIIEGRAEHYWWRGQNRGTLRVAQFPRHVVTA
VAGLSARDISRPLKHSFIHTGHGDTDPHRSWGHADRIDSLYLGNPMDPPDVLGMEPGIAR
PTKLPNRSKNLFYCPKLTVQGFLIGIIQRLGASSSGLKRLGASLGLKLRPWDGSAVRPAK
SEVSLIDFTDDSFSSTTPSPLAETRQPDEDTLKSTVHRSRPQDTPSILDWPLPQPTYDVV
AAELEDQSEDQEVRTINKGSAEEAAAAPRSESQSADLFQELQREVMMQVMVKLQVPMATG
RSLPSSPLPMPLAPLGPHRQIYLPPPSPTAASSFACCFEDRPVLPPRSPVPPLRPSKRNL
PTRGAHSLCLGNGEDTPPQLPPRDHAFSQPGSRSSSPLPLVVPPLSSYPLSLPPPPLTVS
PRRASGHLGPLLSTNPSSSPAPATSRLAARGSSYSSGALLDPLAFSEGRGLSSLVDSSAP
APLPERPAFLERYLNGKETSSVESLTHVYVTYGAANMAAVKPMIQQPGGAKPNSSYNNNN
NGRTSAPSMQQEQSVTQVQGAVHGVTLEECQAALQSHNWSISQAINHLKVEQLFRLGLRS
RAECEELLQRCQLNLEQASALMLDTYGPHRNKY
Download sequence
Identical sequences G3NP62
ENSGACP00000007126 ENSGACP00000007126 69293.ENSGACP00000007126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]