SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007180 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007180
Domain Number 1 Region: 15-140
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-50
Family Phosphotyrosine-binding domain (PTB) 0.0000905
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007180   Gene: ENSGACG00000005436   Transcript: ENSGACT00000007198
Sequence length 264
Comment pep:known_by_projection group:BROADS1:groupXIX:6921327:6924109:1 gene:ENSGACG00000005436 transcript:ENSGACT00000007198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQRKKYSNSNYIMQETSQYHVEHLSTFIMDKTESIVTVDDAVKKLMLLDSKDKIWTQEML
LQVTDKAVRLLDCDTQEELENFPLPTIQMSQTVLNQTRYPSVLLLVCQDKEQHRPDIHFF
HCDEVGAEMVHADIDSAIGDNKHGKKMRLQTLKVNQEKMKRHRETILPPSAPKSPSPAAK
GRVAAMSTQGEGARTSHAARALKNPQTSRQSDAEAHEKLTQNIEMDVQILNCSLDDIEIF
VARLHKALDAFTQLNQRNKSKKNK
Download sequence
Identical sequences G3NPB6
69293.ENSGACP00000007180 ENSGACP00000007180 ENSGACP00000007180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]