SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007216 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007216
Domain Number 1 Region: 488-645
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-36
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 2 Region: 203-302
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000289
Family PDZ domain 0.035
Further Details:      
 
Domain Number 3 Region: 12-80
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000151
Family SAM (sterile alpha motif) domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007216   Gene: ENSGACG00000005455   Transcript: ENSGACT00000007234
Sequence length 997
Comment pep:known_by_projection group:BROADS1:groupXXI:11312755:11333588:1 gene:ENSGACG00000005455 transcript:ENSGACT00000007234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPLLLSPSLFLSSSHLCCWLFGLDDCLQQYVCVFERGGVCGERLLRISHAELEELGVSRI
GHQELILEAVDLLCALNSGLETESVRTLAHKLGASAKNLQNFISGRRRSSQSESRSSRRL
PNDLLTSVVDLITAAKSLLAWLVRSPFAAVADYSVTRNNVIQLCLELTTIVQQDCTVFET
ENKILHVCKTLSEVCEHIVCVSSDPLVSQSAHLELVHLTNVKTSEGLGMYIKSTYDGLHV
ITGTTEGSPADRCKKIHAGDEVIQVNHQTVVVGWQLRNLVGSLRADKGVVSLTLKKRPQS
TLSSAPALLKNMRWKPLALQPTRSPGSSSATPSGTPTKSSAIQDLYIPPPPAEPYTPRDE
TGTLPGDEGGRSHGGVGVAKRSESPNSFLDQESHRREEEEPAYCTTPTYGRLRPISMPVE
CNWVGDYEDPAKLNRENRREATLMRYVGLSGVDERTGSEDYSSHTARPGKRTNDTAKRAK
RRSHHSQSPSHYVLQTNQRDSPPRDAASVYHTYQQASSLQAKNRKKNRGRSLASLSRRRV
SCKALGRGDCEGWLWRKRDAKGYFSQKWKKYWFVLKDNCLYWYINEEDEKAEGFVSLPEF
KIDRASECRKKYAFKACHPKVKSFYFAADGVDDMNRWLSRLNMAAVGYAERERIRQEQDY
WSESEHEEDTTSSPKQDSPPPPYDTYPRPPSMSAYLEGRTTRLSSTETSRSRSSQEDFYR
SSPTGGSSETGSPGRSSSSQRRSWQDLIETPLTEAGLHYLQTGPLGTDTPDASCLQPDTN
SMGIFDSDKCRVQRNVPLPMAMQRLIPMATQGGKPRSFTLPRDSNLHTLLTPPAKERQHA
HSDDTVDVANEAEETTARRLPRSSLEPGEGGSEGASLGDLFRACEQGGVCPLGRGSDARG
QSECRQSFLRRAADPQLNERLHRLRILTSTLKVGQEGELALIDRLLSIPSCRRELQEWKR
AYQELFSQKPDSAADSDPGPPLTPSFSHTHSYIETHV
Download sequence
Identical sequences G3NPF2
ENSGACP00000007216 69293.ENSGACP00000007216 ENSGACP00000007216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]