SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007438 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007438
Domain Number 1 Region: 221-367
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-27
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Domain Number 2 Region: 19-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.2e-26
Family Pyk2-associated protein beta ARF-GAP domain 0.0018
Further Details:      
 
Domain Number 3 Region: 132-230
Classification Level Classification E-value
Superfamily PH domain-like 2.49e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007438   Gene: ENSGACG00000005624   Transcript: ENSGACT00000007457
Sequence length 376
Comment pep:known_by_projection group:BROADS1:groupV:7022762:7031628:-1 gene:ENSGACG00000005624 transcript:ENSGACT00000007457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVELQSKCLFSYMLKLAESTCCVCAFPPAEPDWASLTLGVFVCQACSLLHRSIPHISRV
KSVQDTWDASEVELMATTGNNAAKAKYEQTVPAFYYRPTHSDCKMLREQWIRAKYERNEF
EFIEKQEPYSAGYRDGFLWKRGRDNGQFLSRKFILSEREGALKYFNKQDARDPKALMKIE
TLNATFQPAKIGNPCGLQITYLKDNSTRNIFVYHSDAKEMVDWFNAIRAARFHYLQVAFP
GASDEELVPKLTRNFMKEGFMEKTGPKHTEGFKKRWFTMDDRRLMYFKDPLDAYARGEVF
IGSKENSYTVLSGLPSSTQGHHWNHGITIVTPDRKFLFACETEAEQRDWIAAFQRVINRP
MRPQEYAVEAHFKHKP
Download sequence
Identical sequences G3NQ22
69293.ENSGACP00000007438 ENSGACP00000007438 ENSGACP00000007438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]