SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007442 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007442
Domain Number 1 Region: 399-463
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000047
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.023
Further Details:      
 
Domain Number 2 Region: 107-173
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000253
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007442   Gene: ENSGACG00000005627   Transcript: ENSGACT00000007461
Sequence length 3784
Comment pep:known_by_projection group:BROADS1:groupXII:6613631:6683733:-1 gene:ENSGACG00000005627 transcript:ENSGACT00000007461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVGMGAGGGGGSRPGEPYRLATHETPTSPRHMQSTQGPGMGPGMGPGPGTGHGPAGSSA
HASRRNLQVDFSGSGGSRRGRSPSGSPDRGVTPTSPYSVPQIAPMPSSKLCPVCSSTQLS
NPPAPPNYNTCTQCKSTVCNQCGFNPNPHLTEVQEWLCLNCQMQRALGIDMTTPRSKSQQ
QIHSPSHQAKPIVQPQQPTPQPTQPAAAAPSKPLAQSQPSQRQRGPNQPGGPRIPHPGAV
PLPGLARAPSQPDLGRGSPMHQSMARHHDQTRSAGSSPAHRPQSQAPPPAQDGLTKLFGF
GASLLNQASTLINVDPLPTASTQPSPARGNVVFSNAASDNRQQQQAAPGTKPFSMGGPHG
PTQMGGPQASSRMGGPQAPSQMGGPHNKQEPVVAPVPAPEPVKPKVNCPLCKTELNIGNS
DPPNYNTCTQCNGQVCNLCGFNPTPHLVEKKEWLCLNCQTQRLMSGGGLDDPPLPVPHPS
PKHQPMGSPRQQAPASQPSPLHKPTNQQGPRPTQPPAQKALAGTGGSGSFAPSAAKQPTD
PKTATPATAPLSTADTQKQPKASQEKPKTEPENKIGKDTKASQRKGEQITPIKEIKKSRH
YDDTKNNSTHDLSRSPQSLSDTGYSSDGISSSHSEITGLIQEEEMKLSERGISGRGSPPS
PSEITKLESSMRPLLEKSLSEEKVDRRGRKHRDRDLDDRGKQRPRSLSIPPDSYDSDEEL
EDIPEPTEMTDEEFMRRQIMEMSADEDNEGYGYQKPKKNHHKHMISDSGKEKRRLQHHSS
SFEEEPKSSTDVYKGSLEEGEEDVMASQGGLRRFKTIELNNTNSYSRDMELGNENDLSLD
REPELEMESLTGSPEERSRGDYSSTLPATSSSYGSGQSPTSISSMEEDSDSSPSRRQKLE
EAKQQRKARHRSHGPLLPTIEDSSEEDELREEEELLREQEKMREVEQQRIRSTARKTKRD
KEELRAQRRRERSKTPPSNLSPIEDASPTEELRQAAEMEELHRSSASEYSPQSLDSEAEG
YESKLYKSGSEYNLPTFMSLYSPIEKSSTTTTTTAPSSASKSLKSAEEVYEEMMKKAEVL
QKQQQQQQQQHGRHGQYYEEDVNGQGYEEEYEYDQHQAGYDNEAAETEKDIYEEIRQTSQ
NITKMQQATNEQVEIEIESSYSDKQLLDTGSAFAKLLEQSNALLTPGTSPTQISAPVSFV
ETGGRIPDVRVTQHFSAKDGHKDRIKTQAGKNGITPTVAATTIAAYGVYARDAVTISQTS
SSPTMTTTQSGIYGRHTSSPTTSSTTVSSVCSKIAEITQAYSQREVITRRVGEARDVQVR
DSSTSSTERVIEPRSPKYTTYYRSTSPPLSPSPPPPQSPTRSPSRRNTAEFSTQTFSSAL
RMSESAVSGPTSPVTAQGTQTSHRSVSPRLHRQQSSQDVQYSPPPGQARPMTVNTATSPL
SSPTRFSRQSTFDNYSPCSSPPDTPPYQHSPTRSFYRTQRVEKVNVGTSMVTTAGTYTRG
SMSMDNISLCRISTVPGTSRVEQGRMIQGGSVVDLRTASKPAPTIMTDQGMDLTSLATES
RKYHGGSDGSRHSTIVQPLIMNLNTQEIITPTTVSVTVAASMFMTQPKQPTIYGDPHQYQ
MDLGQGIGSAVCLSQNRPPISPPTDPTIPKKRATTSALARYSLTGQISPLLKKDLLVSQT
STASAVVSAVSPVINPDLYGTGPVELKGKPSPPGSISGSNLSHSMVVQMDGGPEQARAMT
QLLTVEVGQDAMDLTGGQIKPENQPACCDVVYRLPFGGSCVGGEKEGIRPPSAPPLTYES
DQERLPEGYHEYPMDERKAYTLPFPGRLQPSMSDTNLAEAGVQSYHPKLEPHLQGPGELA
MDLTAMKQGYGGFMGMQYGSYTDLRHGGDITAQTLPIRRYNSLSNISSDYGYSARDIANF
QEANLAQYSATTAREISRMCAALNSIDRYASNPDLMQFGNLGRGTGPGASRLAAGLGMRQ
NHFFGLDGKPISHSQALTNLINARQASLRAMYPAAIRSADGMIYSTIQTPIASTLPITTQ
PASVLRPLLRGVYRPYPSANMTPVPLTSLSRLPMSPRVPLTVQAPLRYPAPGLLQISSTT
ATSSGAATNVGPAGAPMSVSITTTSSTVQDEPVYLAAHAYLSSTPSHTHSYTQPPVGPSV
PTSGLPISGGLPPFPPPGAVHKEGETEAERLHRQQEQLLQMERERVELEKLRQLRLQEEL
ERERIELKLHRDKEQMIVQRELHELQNIKDQVLQQQQLEREKQLVLQREQLAQQKSQLDQ
IQSLQHQLQQQLVEQKRQKTAAAQNIQVRGPRNTGRTVLEYCRTWRGQNPSPVQSTTGNL
DANGQPLPPYVDSQLGFRSLPNSSSEMCLRSQQEHVETRSNMRKHSSMTRLSRDSLDGDG
VVFYGSPRRIVDSSVQTDDEDGEERYMMRHRTRRRGRSVDCSVQTDDDEDKAETEHPVRR
RRSRFSRHAESSATGSSTAATSTTASDSKTETPKMVSSSIAIQTIREMSCQTEVEHLGRV
SPAIHVTVPDPNKVEIVHYISGPERTQKGQSLACQTDTEAQSQGVVAPQLSVPTTVSPYS
SSTSTGTQQSANAAKFERRRPDPLDINYQPHNHLHNESLSTIIRQHQTAPKSPQVLYSPV
SPVSPHRLLENSLSSERLNKAHVTPQQKSYTAESPQRHPSVPRPIKSTQRSMSDPKSLSP
TTDEHTRARLSLYQQQVLQSQQLAALQQSSLLRKVKRTLPSPPPDENTTSAHLPMMAPSL
QQVYLPSVPSLKPSSRSGLAAKASLLKDLTHELKAVEQESTKLRKQQAELEEEEKEIDAK
LRYLELGIHQRKETLVKERERRDIAYLRCMGDTRDYMSDSELNNLRLAAAAASRQYPQSQ
QAAPMPQSNVPYQASTFNQPPYPSVSQSQAVPQPTPLQSHVPPLGPSYPSQTSYPSHTYP
QSFGPAPPGQPPYPTHSSPYPSAVSSYPGQTTPYPGQPQADILTVHQGRPRQTSLADLEH
KMPTNYETISNPTVVVTTTAQDCNYSSAAPSYGQYTGMTTMASSYGPYGSAPVSSSYDSP
SIYSSSDGMYGAPGLEQNIPRNYMMIDDVSELTAKDGLGTTTGDMMHHGGSGRYPGDIHG
HITTVGSSTRGGTGNSYGRAPEEEAAMQEELYDHHGRGGSSSSVSSSMGGGSSYHSDYDY
KHGSIRSGVQKPMSSTRSLLAPAVMSSKRNKHRKLGSMEQKISKFSPIEEARDVEADLAS
YSSTTGGAYPSSHIRGRQLIEDYGFKSNTYEGGSGSTHGSRHYGSTVEEDDRIYYNSTGR
SRSTGYGMDKISARDYSGYRSRSYERDDRSYRSGYSRGRNPTRQYSEEESPLSPLRRFMG
SGRSSSLGPDPYYGSSHSLPDVQDHIQDLPRTHVYKSDDTYIIDDYHCAVSDSEAYHLGQ
EETDWFEKPRSSSRHYGSSHSSGRSRHGVKHTYHDYDEPPEEDLWPQDEYGHGGRHSTSR
DHRHQSSSGRHSSASRHSDEQRSSRSAKGHPKDPSMRQDPSARSSSTGRRGESRSGGYHT
SDYSRDPSGHHHGQRSSRQGDPHRSSRSKSQQQVDMQGQPPGSGRQSGPGSQTDGAQGQR
TQLQQQAQTSAARSGQPGAAMTTGPQQQPSAQGQGMGMGQGQAKPGQMGPAGGPMGQARQ
TGPAGTTPANMKPDDANHNTKGEQLPLSPPPLKSKHAKMDMPPVTAIGAKAAPVMATKAA
QPPLTGIGSKAAPRPGGIGSAAAGQPGMEGDSMLSKLIPGNAAEQAGKLGDAISGFGKKF
TSLF
Download sequence
Identical sequences G3NQ26
ENSGACP00000007442 69293.ENSGACP00000007442 ENSGACP00000007442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]