SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007451 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007451
Domain Number 1 Region: 1079-1289
Classification Level Classification E-value
Superfamily SET domain 1.31e-68
Family Histone lysine methyltransferases 0.001
Further Details:      
 
Domain Number 2 Region: 965-1091
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-30
Family PWWP domain 0.00000547
Further Details:      
 
Domain Number 3 Region: 275-402
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.02e-24
Family PWWP domain 0.0041
Further Details:      
 
Domain Number 4 Region: 1321-1379
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000133
Family PHD domain 0.0051
Further Details:      
 
Domain Number 5 Region: 934-979
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000084
Family PHD domain 0.0037
Further Details:      
 
Domain Number 6 Region: 704-754
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000399
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007451   Gene: ENSGACG00000005630   Transcript: ENSGACT00000007470
Sequence length 1428
Comment pep:known_by_projection group:BROADS1:groupXIII:3958240:3971504:-1 gene:ENSGACG00000005630 transcript:ENSGACT00000007470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEGTCDSDPGEDGGPSYDAALDAEFSYPPSA
SEDMSHVSNGYPPGLGMYEPQAKFSMYSQFPNGSANGYGAIRSYGDHVLMPGEGTVLRGP
GLQERPLSPVPPPSLVDNTPSSQPPLGLSNTPDGPLKKTSSPEIKLKIIKTYQNGKELFE
SALCGDLLQELQKDEATPTQRRHERKKEKRKKSAQLQLQEQDLDQSQEQQAQEGTTEQTE
DPNAQPRETETPPAPTEKPPKTTIKVEPKTPKETGFCKEFVIGDLVWSKVGTYPWWPCMV
SSDPQMKVHTRINTRGHREYHVQFFGSVAERAWIHEKRIVLYQGKQQYEDLQAETLRRAT
NPVEKHKLLKPIPQRERSQWEVGVGHAEDAFAMSRQERIDNYTFIYVDPDPIEGPSSRKP
TIRAEKRNRRSSGSVGKKEDISNADDAANSKASHEDKDQKGDSPKPDAGGDARQGSPPPV
RAWKTAAARKLLPLSITMKRLNVEITKCDWPLLQKKAALSPKKEQLVAREARQPDLGYCS
PEDSRAKPEPSQSPASRRSEEGGMQQTSSPGSHHSSPHGSQERKLQRRSVRSRSESERGN
DPVPKKKTKKEQAETAPETTLKTGSQKGASEISDACKPLKKRSRASTDVEMASSQYRDTS
DSDSRGLNDPQGLFGKSLDSPAAADADASDTQSVDSGLSRQDGSAGKRDTVCQVCEVYGE
GLLVCEGDCGRQFHLDCLSLTAPPEGRFTCLECMNGNHTCFSCKTAGREVTRCSVSGCSC
YYHEDCVRKLPGTSGGSDGGFCCPQHSCSTCCLERDLQRASKGRLMRCIRCPVAYHTGDS
CVAAGSVALTHHIMICSNHSGAKRNGLLTSPINVGWCFLCARGLLVQDLTDTILSSYAYK
SHYLLTESNRAELKLPMIPSPSSATKKNVGKDAGGKLLCCDTCPASFHPECLEMETPAGP
WSCSDCRAGKKPHYKQIVWVKLGNYRWWPAEICNPRLVPSNIQSLRHDVGDFPVFFFGSH
DYYWINQGRVFPYVENDKNFVTGQININKTFKKALEEAARRFQELKAQRESREALEQERN
SRKPPPYKIIKSNKPVGKVQVHVADLSEIQRCNCRPTDEHPCSLNSQCLNRMLQYECHPQ
VCPAGDSCENQCFSKRLYAETEVIKTDGRGWGLQTNQALRKGDFVTEYVGEVIDAEECQQ
RIKRAHENHVADFYMLTLTKDRVIDAGPKGNSSRFMNHSCRPNCETQKWTVNGDVRIGLF
TLCDVEAGTELTFNYNLHCVGNRRSSCHCGSDNCSGFLGVQPTSAVVMEKEEKARNAKLK
PKKRKLRPEGKQTHEYCCFCCGEGGELVMCDRKDCPKAYHLLCLNLTKPPYGRWECPWHD
CSQCGAPASSLCDFCPSSFCRDHEAGALTSSALEGRPCCPGHDPASPL
Download sequence
Identical sequences G3NQ35
ENSGACP00000007451 ENSGACP00000007451 69293.ENSGACP00000007451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]