SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007492 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007492
Domain Number 1 Region: 198-253
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000124
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007492   Gene: ENSGACG00000005664   Transcript: ENSGACT00000007511
Sequence length 328
Comment pep:known_by_projection group:BROADS1:groupXIII:4002738:4009479:-1 gene:ENSGACG00000005664 transcript:ENSGACT00000007511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRMDDPEYGVQIGENKFIRKATVLSHLKTYNLYYDGQNLQLRHKAAPLSQQEEGELIVEG
LLNIFWGLRRPIRLQMQDDHERIRPPPSSTSWHSGCNLDSQGTESQQSPPTLEVTPPDCQ
PEEADEMEEQAEVDWSEDSETSAQLLRTKSDAGVLRRGQRRSPSDQRKIRRHRFSINGHF
YNHKTSVFTPAFGSVTNVRINSCMRTPQVLRVLLNKFKIENSPDDFALYLVHTSGERVKL
KRSDFPLVLRIMQGPCEQVCKVFLMEEDLGEEVTYDVAQYIKFEMPVLQSFITKLKEEED
REVLKLRSSFTSIKSIKHKEKAQKVHSR
Download sequence
Identical sequences G3NQ76
ENSGACP00000007492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]