SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007499 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007499
Domain Number 1 Region: 16-178
Classification Level Classification E-value
Superfamily PH domain-like 1.12e-38
Family Phosphotyrosine-binding domain (PTB) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007499   Gene: ENSGACG00000005672   Transcript: ENSGACT00000007518
Sequence length 508
Comment pep:known_by_projection group:BROADS1:groupVIII:4978476:5049357:-1 gene:ENSGACG00000005672 transcript:ENSGACT00000007518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAKSKYNLVDDGHDLRIPLHNEEAFQHGINFEAKYIGSLDVTRPSSRVEIVAAMRRIRY
EFKVKNIKKKKVNIVVSVDGVRVALRKKKKVCRCQKKEWTWDESKMMVMQDPIYRIFYVS
HDSQDLKIFSYIARDGQSNVFRCNVFKSKKKPTQSQAMRIVRTVGQAFEVCHKLSLQHTQ
QNADGQEDGEKNGNDSTAKSPARELSGAEKTPTVSEETDIDAEDAGHESAAELNLNRGVT
DLDATAKPAEPDHEESKASEEASLLIASPRMLLPPSGTLPPGAPLSVHHQIQLLQQQLQQ
QQQQTQVAVAQVHLLKDQLNAEATARLEAQARVHQLLLQNKDLLQHISLLVKQIQELELK
MSGPNSMGSQDSLLEITFRSTIPAVICDPTTPKPDVSAPHLPALGSTDGTGNAFSSSNGT
LGSPLGRDKCLLKLECFRFQPTPDVKPLSCLDFAARFRESGIASEYESNTDDSDDEIFGW
GRDEETLRLLNVLNRQETPDCLGDEIAV
Download sequence
Identical sequences G3NQ83
ENSGACP00000007499 69293.ENSGACP00000007499 ENSGACP00000007499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]