SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007521 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007521
Domain Number 1 Region: 133-330
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 13-175
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-32
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007521
Domain Number - Region: 627-697
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007521   Gene: ENSGACG00000005702   Transcript: ENSGACT00000007541
Sequence length 715
Comment pep:known_by_projection group:BROADS1:groupV:7593860:7610907:1 gene:ENSGACG00000005702 transcript:ENSGACT00000007541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVSRGPCRPASPSLQEGALKAGWLKKQRSIMKNWQLRWFVLRSDQLFFYKDEEETKPQ
GCIPLQGCQVNELTANPDEPGRHLFEIVPGGTGEKDRAAISHESFLLMANSQTDMDDWVK
AIRRVIWAPFGGGIFGQRLEDTVQYEKKFGPRLAPLLVEQCVDFIRERGLDEEGLFRMPG
QANLVKELQEAFDCGDKPLLDSNTDVHTVASLLKLYLRELPEPVIPFSKYEDFLNCAQLL
AKDEEEGVQELGRQVNTLPIPNYNLLTYICKFLDEVQSHSSQNKMSIQNLATVFGPNILR
PKIEDPVTIMEGTSLVQHLMTILIREHNRFYSGRDQEASSVPQTEVSAQGPQLQHRSLGA
WISEEDLQSCPVSNLDQELHSSASSLDAKLCAAVSPTQTANLNPGPKLGSPSGKGETVVS
PSKQAKTIPSWKYSFKSSSGKPSSGGGGSMADVASVPSGGGGGGGNWLMNGLSSLRGHRR
TSSGERSARDRDSTGSSQRLSTYDNVTSSSSMGSVPSVTSTPWSTSSCEISVPDSGSEPS
ANQSCGVGGDGGGRAEWMERQRETDGGLTTDLSSEQDSCEAMELCGSSAACSENGNAAST
AAGLPSIVTSEDGDETMMLSGLVEGLKDELRKQKTTYEIRIQKLEESSAALCAQMECLEQ
EMEQERKKQRMLEIKLRNSERARQDAENRNSLLEKEMEDFFSTLGDLALGTRTSD
Download sequence
Identical sequences G3NQA5
69293.ENSGACP00000007521 ENSGACP00000007521 ENSGACP00000007521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]