SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007526 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007526
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily PH domain-like 8.2e-35
Family TFIIH domain 0.00000441
Further Details:      
 
Domain Number 2 Region: 104-147
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000000000249
Family BSD domain 0.00014
Further Details:      
 
Domain Number 3 Region: 184-232
Classification Level Classification E-value
Superfamily BSD domain-like 0.00000405
Family BSD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007526   Gene: ENSGACG00000005659   Transcript: ENSGACT00000007545
Sequence length 546
Comment pep:known_by_projection group:BROADS1:groupXIX:7102439:7106663:-1 gene:ENSGACG00000005659 transcript:ENSGACT00000007545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLSEEVLLVVKKVRQRKQDGTLYLMAERIAWGPEGKDRFSVSHLYADIRCQKISPDGK
AKIQLQLVLHTGDSTTFHFSNDSTALKDREAAKELLQQLLPKFKKKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISADEFWANRLGDTNHADPSLSNNKQEVGISGAFLADIRPQTDG
CNGLRYNLTADIIESIFRTYPTVKQKYCENVPHNLTEKEFWTRFFQSHYFHRDRINTGTQ
DIFSECAKQDEKGLKSMVVQGVKNPLVDLLSLEDKTLDEGYGVCTTASTSNPNRTVKDSS
NSAIIKRFNHHSAMVLAAGSQKGEIPASETSSTDGNSRDSDFFQPPVKKVRLQETMEYED
LQGENRPKTVALNLKKSDRYAHGPVPLQSQHYTTSQEIINSVNNIRDEMLNYKPNLSQVL
SNTTASSAIAALSSGGVLMKAATQQAINQMVPSEVQGELKHLYAAAGELLRHFWTCFPVN
TPFLEEKVLKMKSNLERFQMTKLCPFQEKIQRQYLSTNLTGHLEEMLQAAYSKFHVWQTR
RMLRKT
Download sequence
Identical sequences G3NQB0
ENSGACP00000007526 ENSGACP00000007526 69293.ENSGACP00000007526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]