SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007564 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007564
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.99e-25
Family Ubiquitin-related 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007564   Gene: ENSGACG00000005735   Transcript: ENSGACT00000007583
Sequence length 141
Comment pep:known_by_projection scaffold:BROADS1:scaffold_1226:793:2441:-1 gene:ENSGACG00000005735 transcript:ENSGACT00000007583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQITLKTLQQQTIQIEIDPEQTVKALKEKIETERGKDNFPVSGQKLIYAGKILQDDTPIK
DYNIDEKNFVVVMVSKNTGLTTPSPELAEREAPKPSVQDSGSTSTAVPATTSAPVAAPAA
VPIPPEEAKEEPSADATEPQP
Download sequence
Identical sequences G3NQE8
69293.ENSGACP00000007564 ENSGACP00000007564 ENSGACP00000007564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]