SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007573 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007573
Domain Number 1 Region: 63-167
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-26
Family Second domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000093
Family First domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007573   Gene: ENSGACG00000005743   Transcript: ENSGACT00000007592
Sequence length 178
Comment pep:novel group:BROADS1:groupV:7639898:7640978:1 gene:ENSGACG00000005743 transcript:ENSGACT00000007592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVAHSNLVEHFYFALAYIDDNEFFFLDNDTKISKVAPDSWKKVPTTTFVLFLRIKFFVN
DICLLHKQTCHQYYLQLRRDLLEDQLSCHEETALYLGALALQSECGDCMPEVYGKNYYRP
NQYVSKSVMEKRALPLIQAELLRLHANNAQMLTDESELEFLKVCQQLPEYGVLFHRVI
Download sequence
Identical sequences G3NQF7
ENSGACP00000007573 69293.ENSGACP00000007573 ENSGACP00000007573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]