SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007579 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007579
Domain Number 1 Region: 841-964
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.34e-25
Family Ankyrin repeat 0.000000672
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.38e-18
Family Ras-binding domain, RBD 0.016
Further Details:      
 
Domain Number 3 Region: 970-1031
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007579
Domain Number - Region: 165-247
Classification Level Classification E-value
Superfamily TM1646-like 0.0379
Family TM1646-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007579   Gene: ENSGACG00000005738   Transcript: ENSGACT00000007598
Sequence length 1040
Comment pep:known_by_projection group:BROADS1:groupXV:1958826:1978503:-1 gene:ENSGACG00000005738 transcript:ENSGACT00000007598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLQVILTVYLNDTQQMLTEVPVTPATRVIDVVEYCKEAGEGECHLAEVWNGHERVLPQEV
LLLDLLQQWGARRPEVGFYLRHCPSWTQGSPQSLEQSSATEATQSADDKGMHTHSLFGNP
ILSLLTLSELQEMATKQYQQIEAQQQMLVRQVEQRLRYLHQGGRLNQAQTQSEAEKLQRL
KERVETQEAKLKKIRAMRGQVDYSKLINGNLSAEINHVSSLFQEKQAELQSAVVRVDQLS
QQLEDLRRGRLQGATAGQRGSPLSGPAALELRKLYQELQARNRHNVEQSSKLAQNKELLN
KRNAQVTVMDQRIGDLRERLHKKRAEVRVLTLLPLLSRMNGGGPSSPQASAHPGAAVSGR
VAAVCPYIQVPAEGRQEAGHGPAADPPPKPTPLGHVRSLSANEASWPSISKNALDWRTNG
PEQVQLCFHTSRQPSGFRLNVSPSPQPPSGYGTYPSATHQAAGHPCATSSLPRSAPGTLG
WPRSNAANTPSSSSSSSLQEIHQRVSIPQSPIRGSASQPSPLSPQTERTDPPPAVAVRPY
VPDHPSRPQSPRKGPATMNSSSIYSMYLQQPQAKSYGSLSNRTAVKAVYGKPILPTSSTS
PSPVPFPGREEFTDKEGGKGGGESGDGQILPPPTVDNIPRPLSPTKLTPVAHSQLRYQSD
ADLDVLRRRLSNAPRPLKKRSSITEPEGPQGPNIQKLLYQRFNTLAGGMEGGSANGSVEP
CDKHVAAGAAESEARNSGSRRSSPPVSIETPKETTAKADNGVNVSPPAQTGPPPATERPE
DQNNNNKRGSSPAQNSAGPASPSPSPLAPPSLPKVKRTNLKKPSSERTGHGLRVKFNPLA
LLLDASLEGEFDLVQRIIYEVENPSMPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAA
DSDGWTPLHCAASCNSVHLCKMLVESGAAIFATTISDVETAADKCEEMEEGYAQCSQFLY
GVQEKMGVMNKGLVYTLWDYTGQQADELSFGEGDALSVLRRRDDTETEWWWARLNDREGY
VPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences G3NQG3
ENSGACP00000007579 69293.ENSGACP00000007579 ENSGACP00000007579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]