SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007667 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007667
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-23
Family Ubiquitin-related 0.000038
Further Details:      
 
Domain Number 2 Region: 226-291
Classification Level Classification E-value
Superfamily XPC-binding domain 3.66e-22
Family XPC-binding domain 0.0000635
Further Details:      
 
Domain Number 3 Region: 149-199
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000072
Family UBA domain 0.00047
Further Details:      
 
Domain Number 4 Region: 309-357
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000175
Family UBA domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007667   Gene: ENSGACG00000005805   Transcript: ENSGACT00000007686
Sequence length 360
Comment pep:known_by_projection group:BROADS1:groupXI:2238081:2242496:-1 gene:ENSGACG00000005805 transcript:ENSGACT00000007686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQITLKTLQQQTIQIEIDPEQTVKALKEKIETERGKDNFPVSGQKLIYAGKILQDDTPIK
DYNIDEKNFVVVMVSKVRSYSTHHSNSEAPKPSVQDSGSTSTAVPATTSAPVAAPAAVPI
PPEEAKEEPSADATEPQPASSSAAGQGLDASSALVLQSYESMLTEIMSMGYERERVVAAL
RASFNNPHRAVEYLLTGIPSSPVQESNPPAQAPLSGPPEAPPLAEGENPLAFLRTQPQFL
HMRQAIQQNPTLLPALLQQLGRENPQLLQQISQHQELFIQMLNEPVGEGGEAPEVGELGA
AGEEGAPVNYIQVTPQEKEAIERLKALGFPEALVIQAYFACEKNENLAANFLLNQGLEDD
Download sequence
Identical sequences G3NQQ1
69293.ENSGACP00000007667 ENSGACP00000007667 ENSGACP00000007667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]