SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007730 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007730
Domain Number 1 Region: 547-672
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-20
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 2 Region: 88-264
Classification Level Classification E-value
Superfamily ARM repeat 0.0000096
Family HspBP1 domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007730   Gene: ENSGACG00000005835   Transcript: ENSGACT00000007749
Sequence length 726
Comment pep:known_by_projection group:BROADS1:groupX:8300498:8348647:-1 gene:ENSGACG00000005835 transcript:ENSGACT00000007749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPADIVKVAIEWPGAFPKLMEIDQKKPLSAIIKEVCEGWSLGNHENFALQIADATNFY
ITEKNRNDIKNGSILRLTTSPYQTAVQLHERIQSSSMDAKLESLKDLASASRDITFAQEF
INLDGISLLTLMVESGTERYQKLQKIMKPCFGDLLSFTLTAFVELMDHGIVSWDTFSVAF
IKKIASYVNKSAMDTAVLQRSLAILESIVLNSQDLYHKVAQEITIGQLIPHLQGTDQDIQ
TYTIAVINALFLKAPEDKRQEMAHILAQKQLRSIILSNVIRSPTAINAEMAHQLYVLQVL
TFNLLEDRMMTKMDPQDQAQRDIIFELRRIAFDVECEPNNSGSIEKRKSMYTRDYKKLGF
INHVNPAVDFTQIPPGMLALDNMLYFARHHQDAYIRIVLENSSREDKHECPFGRSSIELT
KMLCEILKVGELPSENCPEFHPMFFTHDRSFEEFFCICIQLLNKTWKEMRATSEDFNKVM
QVVREQIMRALTVKPNSLDQFKSRLQNLSYTEILKIRQSERMNQEDFQSRPILELREKIQ
PEIMELIKQQRLNRLCDGTCFRKISSRRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVAH
DSLQDKLPVADIKAVITGKDCPHMKEKGALKQNKEVLELAFSVLYESDEYLNFIAPDKHE
YCMWTDGLNALLGKEMTSEYTKSDMDTLLNMEMKLRLLDLENIQIPEAPPPIPKEPSNYD
FVYDCN
Download sequence
Identical sequences G3NQW4
69293.ENSGACP00000007730 ENSGACP00000007730 ENSGACP00000007730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]