SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007777 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007777
Domain Number 1 Region: 529-898
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.01e-134
Family Hect, E3 ligase catalytic domain 0.00000000000905
Further Details:      
 
Domain Number 2 Region: 3-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.34e-23
Family PLC-like (P variant) 0.00000493
Further Details:      
 
Domain Number 3 Region: 355-388
Classification Level Classification E-value
Superfamily WW domain 0.00000000000178
Family WW domain 0.0013
Further Details:      
 
Domain Number 4 Region: 319-354
Classification Level Classification E-value
Superfamily WW domain 0.00000000000223
Family WW domain 0.001
Further Details:      
 
Domain Number 5 Region: 474-509
Classification Level Classification E-value
Superfamily WW domain 0.00000000000971
Family WW domain 0.00095
Further Details:      
 
Domain Number 6 Region: 429-472
Classification Level Classification E-value
Superfamily WW domain 0.0000000000668
Family WW domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007777   Gene: ENSGACG00000005875   Transcript: ENSGACT00000007796
Sequence length 904
Comment pep:known_by_projection group:BROADS1:groupXVII:4139742:4148936:1 gene:ENSGACG00000005875 transcript:ENSGACT00000007796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMKAQLQVTVLSAKLKENKKNWFGPSPYVEVAVDGQSKRTEKCNNTHSPKWKQAVTVIVT
PVSKLIFRVWGHQTLKADILLGMAILEISETLKGNDLRLCEVVQTLQLCSDRDPRDIVGD
LSVCLDGMQVDPESFASAEREREEGFTTSLYIPYVWGVCRTVHLVLVRISLTILNLATIP
NGTARQNGDTGNRINSENILIPRSSRDTSPSSDSEEWVIVQNGHLANGTGSPSQSPGGSS
ASRPPRPARPPPPTPQRPTASPTSSSSSSPSELSECPASDGSSQASASGCSSSSQTASGP
KPGTSASAALATTTPRIPPMSNGPLPPGWEQRADQNGRVYFVDHIEKRTTWERPDPLPSG
WERRVDPMGRVYYVDHITRTTTWQRPTQESVRNYEEWQHQRSQLQGAMQQFNQRFIYGLQ
DQLAATANKEFDPLGPLPHGWVAEKRTDTNGRVYFVHHPTRATQWEDPRTQGLLNDKPLP
EGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSSLENGPQITYVRDFKAKVQYFRFWCQQ
LSMPQHIKINVSRKTLFEDSFQQSKIMSFHPQDLRRRLWIIFPGEEGLDYGGVAREWFFL
LSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFKFIGRFIAMALFHGKFIDTGF
SLPFYKRILNKPLALKDLESIDPEFYNSLIWIKDNNIEECGLEMFFSVDKEILGEVTTHE
LKPDGGNVQVTEENKEEYIRLVAEWRLSRGVEEQTQAFFEGFNEVLPQQYLQYFDAKELE
VMLCGMQEIDLVDWQRNAIYRHYARSSKQILWFWQFVKEMDNEKRMRLLQFVTGTCRLPV
GGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLMFAIEETEG
FGQE
Download sequence
Identical sequences G3NR11
ENSGACP00000007777 69293.ENSGACP00000007777 ENSGACP00000007777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]