SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007778 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007778
Domain Number 1 Region: 303-369
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.65e-18
Family PHD domain 0.0055
Further Details:      
 
Domain Number 2 Region: 198-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000131
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 3 Region: 260-316
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000731
Family PHD domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007778   Gene: ENSGACG00000005880   Transcript: ENSGACT00000007797
Sequence length 377
Comment pep:known_by_projection group:BROADS1:groupI:2110211:2128414:1 gene:ENSGACG00000005880 transcript:ENSGACT00000007797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAVIKNSLGEEFYKEAIEHCRSYNARLCAERSMRLPFLDSQTGVAQSNCYIWMEKNHRGP
GHAPGQLYTYPARCWRKKRRLNILEDPRLVPIEFKIDYEASLKKEGGIPDGPVLESLLAG
ETLDKKVETKEEEPMSECQPFSRCLTTSEKLLVGDFPHELEVDEIEEDVPKRKNRTKARA
YGVGGMRKRQEPAAIEDRDKPYVCDICGKRYKNRPGLSYHYTHTHLADEEGEEDSERHTL
PFQRKNNHKPKKAPDGSVIANGYCDFCLGGSKKTGCPEDLISCADCGRSGHLSCLQFTVN
MTAAVRTYRWQCIECKSCSLCGTSENDDQLLFCDDCDRGYHMYCLSPPMSEPPEGSWSCH
LCLRHLKEKASAYITLT
Download sequence
Identical sequences G3NR12
ENSGACP00000007778 ENSGACP00000007778 69293.ENSGACP00000007778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]