SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007781 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007781
Domain Number 1 Region: 125-230
Classification Level Classification E-value
Superfamily Second domain of FERM 1.83e-24
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 2 Region: 231-376
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-24
Family Third domain of FERM 0.0035
Further Details:      
 
Domain Number 3 Region: 16-117
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000241
Family First domain of FERM 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007781   Gene: ENSGACG00000005885   Transcript: ENSGACT00000007800
Sequence length 550
Comment pep:known_by_projection group:BROADS1:groupVI:7069392:7074570:-1 gene:ENSGACG00000005885 transcript:ENSGACT00000007800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESTSAIMSNSMKQERTICVLLPNKDQLDITFGPKTSGQDVLNRVAERLGIKQLHFFGLT
VVRDNEHIFLDLEEKITKYFPKEWMQDFGKVRHLVAKGLLKRPLPLVLCLKVQYYIENGR
LFCTSERKARHLYYSDLRERVLRSECRQQEEVYFQLAGYALQASLGDHHLPREGMEVTPY
FEPKEYFPPWILSKRGPDYLLCHGPKVHQELWGMSTREAMLLFIKEACRLEDVPVTFYRL
QKDKKAEKGTALLGLTLRGMQVYQEVNNMRQMLYNFPWSNVGRLTFLGKKFEIQPDGLPS
ARKLVYYTGSSFRSRHLLLHLSSSHRLYLSLQPALKHIRKLEEGEDKKRYRESYISDDLD
MDPPGSESSPGLSRRSTSSSGIEADARQHSLSAEMGSMEEEGQRQAENCLGSAASRGSAR
TSGFHTGRRARIEDEGWQEEEGVLVDSPDEMFQLADLLEGVSVDCSELSSETLASEKIFV
SAENKACLPDSDGDLKKLRNRDTLKQMVKYRAQVCVDRHSQSIDDVSLFPPAASLGTTLP
PDSSHSYTCG
Download sequence
Identical sequences G3NR15
ENSGACP00000007781 69293.ENSGACP00000007781 ENSGACP00000007781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]