SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007783 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007783
Domain Number 1 Region: 51-458
Classification Level Classification E-value
Superfamily Ras GEF 3.66e-96
Family Ras GEF 0.00082
Further Details:      
 
Domain Number 2 Region: 521-590
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.14e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00082
Further Details:      
 
Domain Number 3 Region: 454-557
Classification Level Classification E-value
Superfamily EF-hand 0.000000000757
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007783   Gene: ENSGACG00000005888   Transcript: ENSGACT00000007802
Sequence length 774
Comment pep:known_by_projection group:BROADS1:groupXV:2129180:2141025:-1 gene:ENSGACG00000005888 transcript:ENSGACT00000007802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVNQERRNPTRASPGCISRSRVSPPGRPHRFHKPGPAQSAPVKSMMPLGPLTKGGSWEDL
IQACLQCFDSDGGVCGSGHLLNITLAMHRIHISSCELLDKLATQYPKALDNEQPTECQRI
CYLIRHWIQEFWMMFRLHHSLSDRLDQFRELIREQGQEHLCSLLETKFISERDWSWKASQ
KIKANSSKKRKVSLLFDHLEPIELAEHLTFLEFKSFCRISFVDYQNYIRSCCMKDIPVME
RSIALCNGISQWVQLMVLSRPTAQLRAEVFTKFIHVAKNLHIMHNYNTLMAVVGGLCHSS
ISRLKDTTSHVPSEVTKVLNEMTDMLSSCRNYDNYRQAYSRCTGFKIPILGVHLKDLISV
NEAMSDYVEDSKVNVQKLQALYSHINELIQLQLIPPRLDANKDLVHLLTLSLDLYYTEDE
IYELSYTREPKNCKALPPTPSRPSVVVDWARGVAPKPDPRTISKHVQRMVDSVFKNYDHD
ENGFISQEEFEKIAASFPFSFCVMDKEKEGLISRAEITAYFMRASVICSKLGLGFVHNFQ
ETTYMKPTFCDNCSGFLWGVIKQGYKCKDCGMNCHKLCKEQVAFECKKNAKKTWAPVFKI
ESFGLVAVDRCYCDMRCQSLVSGSEECPFPYPPDGGKDGSPGSPVPSYPRPRQVHSATQT
EGPHPSPTGTRRPPLLVPAPPPPPPLSSCPSPLPQRKQRHCAKWENGASVARRPRGPDGE
NKPGCEPLESDDERLQETNGTLLRKLKEAEREVEILKTLLKRHALHHVEEDSSS
Download sequence
Identical sequences G3NR17
ENSGACP00000007783 ENSGACP00000007783 69293.ENSGACP00000007783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]