SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007811 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007811
Domain Number 1 Region: 273-336
Classification Level Classification E-value
Superfamily FF domain 1.31e-19
Family FF domain 0.0000354
Further Details:      
 
Domain Number 2 Region: 480-552
Classification Level Classification E-value
Superfamily FF domain 0.000000000000392
Family FF domain 0.0044
Further Details:      
 
Domain Number 3 Region: 621-683
Classification Level Classification E-value
Superfamily FF domain 0.0000000000994
Family FF domain 0.0000541
Further Details:      
 
Domain Number 4 Region: 107-141
Classification Level Classification E-value
Superfamily WW domain 0.000000000131
Family WW domain 0.00052
Further Details:      
 
Domain Number 5 Region: 138-176
Classification Level Classification E-value
Superfamily WW domain 0.000000000542
Family WW domain 0.0015
Further Details:      
 
Domain Number 6 Region: 408-475
Classification Level Classification E-value
Superfamily FF domain 0.000000000612
Family FF domain 0.0078
Further Details:      
 
Domain Number 7 Region: 341-410
Classification Level Classification E-value
Superfamily FF domain 0.0000000419
Family FF domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007811   Gene: ENSGACG00000005886   Transcript: ENSGACT00000007830
Sequence length 844
Comment pep:known_by_projection group:BROADS1:groupXVI:11454668:11465033:1 gene:ENSGACG00000005886 transcript:ENSGACT00000007830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMGPPGIPPHFPPIGMPPMGQRPPSMTPLPPGIIPPGIMPPMGAPPMGQMPGMMPPMMPA
MMMPPHIPAASVQPTGPPGVDPSVAAPGTASATNGSPQDDQPKKKSLWTEHKSLDGKTYF
YNTETKQSTWEKPEDLKSPAEQMLSKCPWKEYKSDTGKPYYYNSQTKESRWTKPKELEDL
EAMIKAEENGTEAMAPGTAAAPAMQADNTAAMVTVMEAEIVAAVSEEHLSQAAVHHVAEI
KTVDAPVASSESSVATEAAASIEVTKEERPELQKKTYKWNTKEEAKQAFKELLKEKGVSS
NSSWEQAMKMIINDPRYSALPKLSEKKQAFNAYKVQTEKEEKEEARIKYKESKETFQRFL
ENHEKMTSTTRYKKAEQMFNELEVWSCVPERDRLEIYEDVLFYLAKKEKEQAKQLRKRNW
EALKNILDNMANVTYRTTWSEAQQYLLDNPTFAEDEELQNMDKEDALICFEEHIRAPLLR
ERRRQRKNREAFQKFLDELHDHGQLHSMSAWMEMYPTLSSDIRFANMLGQPGSTPLDLFK
FYVEDLKARYHDEKRIIKDILKDKGFLVEINTSFDDFGSVISSDKRATTLDAGNIKLAFN
SLLEKAEAREREREKEEARKMKRKEAAFKNMLKLATPPLEPETTWEGIRERFLKESAFED
VTLESERKRIFKDFMHVLEHECQHHHSKTKKHSKKSKKHHRKRSRSRSGSESEDEEYHKK
KKRSQSKSPSERSSSGESGPKPERSYKKSKKHKKKGKKRRHKSASPESDNEKKGRERDGK
REKDLEKDKENDKSRGKSRPDSKQKSPKRKAPKEEGGWDTSGSELSEGELEKRRRTLLEQ
LDAP
Download sequence
Identical sequences G3NR45
ENSGACP00000007799 69293.ENSGACP00000007811 ENSGACP00000007811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]