SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007838 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007838
Domain Number 1 Region: 559-671
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-24
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 702-773
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 152-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-16
Family G proteins 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007838
Domain Number - Region: 58-131
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0176
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007838   Gene: ENSGACG00000005932   Transcript: ENSGACT00000007857
Sequence length 777
Comment pep:known_by_projection group:BROADS1:groupXV:2183538:2188809:1 gene:ENSGACG00000005932 transcript:ENSGACT00000007857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGHGSSSDKGVNTGLICQESYACGGSEEAAFECDECKRLQCVRCELELHSQERLKHHAR
VRIGPGHVPYCDSCKGGNGDGSKRHRSAVRCPNCKVNLCQDCQKRTHSGGNKKKHQLMSY
HVCRACRLLAAQVPDDGKSHRAKLLEKISSFLLVDENEEMQVKEESAFVKSLSCNPDQLL
KVVSIFGNTGEGKSHTLNHAFFMGREVFKTSPAQESCTVGVWAALDPFRKVVVIDTEGLL
GNSSKQGQRTRLLLKVLAISDLIIYRTHADRLHDDLFKFLGDASDAYLKHFTKELKATTA
RCGLDVPLSTLGPAVVIFHETVHTKLLGSEKSSESVDRLLSERFKKLSRFPEAFSSVQYW
GTQTLSPPTDFRGLQNKLEQLLDNNATRSPRTPVVIFKALQALSERFNGEITGELVAHSC
FFPDEYFTCSCLCLSCGSGCKNSMNHLEEGVCHEAKHRCRYSLQYDNRIYTCKACYEGGK
EVVVVPKTSASSDSPWLGLAKYAWSGYVIECPNCGVTYRSRQYWYGNQDPVDTVVRTEIQ
HLWPGSQGFLKDNGNAAQRLLDGVNLVAQSVSELSVKPAKAVSSWLTDQIAPAYWKPNSL
ISVCHKCHAVFQDNDTKHHCRACGEGFCDRCSSKAAPVPERGWGLAPVRVCDGCFEQRAA
YAELLEAEPEEEEGGTLARKVGEAVTNTFGVVATAIDIPLGLMKDGALPAYWVPDQDILS
CHNCQREFTAKLSKHHCRACGQGVCDDCSPERRSVPSRGWDHPVRVCTGCNQKPGDL
Download sequence
Identical sequences G3NR71
ENSGACP00000007838 ENSGACP00000007838 69293.ENSGACP00000007838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]