SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007842 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007842
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.83e-30
Family Ubiquitin-related 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007842   Gene: ENSGACG00000005931   Transcript: ENSGACT00000007861
Sequence length 105
Comment pep:known_by_projection group:BROADS1:groupXVI:11511252:11513627:-1 gene:ENSGACG00000005931 transcript:ENSGACT00000007861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSIRQIRFR
FDGQPINETDTPSQLEMEDEDTIDVFQQQTGGVSIEEGSLFGATS
Download sequence
Identical sequences G3NR75
ENSGACP00000007842 ENSGACP00000007842 69293.ENSGACP00000007842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]