SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007867 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007867
Domain Number 1 Region: 216-284,338-374
Classification Level Classification E-value
Superfamily Second domain of FERM 7.33e-17
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000007867
Domain Number - Region: 378-464
Classification Level Classification E-value
Superfamily PH domain-like 0.000184
Family Third domain of FERM 0.045
Further Details:      
 
Domain Number - Region: 120-210
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00114
Family Ras-binding domain, RBD 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007867   Gene: ENSGACG00000005949   Transcript: ENSGACT00000007886
Sequence length 483
Comment pep:novel group:BROADS1:groupXVI:11519400:11522403:-1 gene:ENSGACG00000005949 transcript:ENSGACT00000007886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVSDPVPIIQGILQTCQDLRPLRDEVYCQLIKQTNHVPHPNSPANRAHWHLLACMCCT
FLPSRGILRYLKFHIKRIKELFPGTEIEMFAHFIGESVKKTKNREFVPSQEEIMALLTRQ
EMTTTVYCHGGGSCKISINSHTTAGEVVEKLIRGLAMEDSRNMFALFEHNDTIDRAVESR
VLVADVLAKFERHAGSEDAEDEGQWKLYFKLYCFLDVESMLKEGVEFAFMFEQAHESLTR
GHFPAREETLQHLAALRLQFLFGDKAKVAWSLESVYPVGRLRSRILQFTKVGGASGSGQT
LERRRTSFLDGTLRRGLKTGSMKKQRMEEEQMLEMWIKEEMSSTRASIVEKWSRLSGLDQ
HQAMLRYMTVIKEWPGYGSTLFDVECKEGGFPHDLWLSVSAENVSVYKRGEPKPLETFPY
EHIIFFGAPQPCTYKITVDEREMLFETPQVGEITKIMKAYINMIVKKRCSVKSVSSYGTN
WIR
Download sequence
Identical sequences G3NRA0
69293.ENSGACP00000007867 ENSGACP00000007867 ENSGACP00000007867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]