SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007935 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007935
Domain Number 1 Region: 10-128
Classification Level Classification E-value
Superfamily PH domain-like 4.79e-48
Family Dcp1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007935   Gene: ENSGACG00000005995   Transcript: ENSGACT00000007954
Sequence length 562
Comment pep:known_by_projection group:BROADS1:groupXII:7484471:7490745:1 gene:ENSGACG00000005995 transcript:ENSGACT00000007954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METVNAGQTMSLAALQRQDPYINKLLDVTGQVALYNFNSKVNEWEKTEIEGTLFVYARSA
SPHHGFTIMNRLSTENLVEPINKDLEFQLQDPFLLYRNGNLGIYSIWFYDKRDCQRIAQL
MVKIVKQEADQSQRESPERAASGRTNGVAEPRPFDILELLSKAKDEYQRAQAGESDVSAE
ADGNAVVNATVQPHSAPQPEKSSRTMVKQITVEELFGSSLPKDPAPPTLLAPNAPTASSD
SDPSAAYLQKPSYPSLPHQNPVFPPHLSAQDPGASQRHQVPGLLPAPYVMQPGPVFHSVA
PRSDPQPRCSVSPLMVLQAGSDARAGPPVVSAPPTRYLGQEMLNTLKAAVPSVNSDIHKP
MLAPNFLPSALFPPHSFREPAGNPLLQHSSEMDVYSPSPNLMKAMSVSSMVFISSTLVAP
LTDIRFICVLSCRLSTSRVFNFNPTYCFFLCRFLSHLFFYLQAVPMSPGLAFPMPPISVL
LSPSAFQQSVSKTPAAASVVPAGPAEPSCASVGASEAPQAACSKAQLQDALIHLIKNDQD
FLGAIHDAYLQSLSKDLGNMKL
Download sequence
Identical sequences G3NRG8
69293.ENSGACP00000007935 ENSGACP00000007935 ENSGACP00000007935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]