SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007942 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007942
Domain Number 1 Region: 429-603
Classification Level Classification E-value
Superfamily Ras GEF 7.45e-25
Family Ras GEF 0.017
Further Details:      
 
Domain Number 2 Region: 49-165
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-24
Family SH2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007942   Gene: ENSGACG00000005999   Transcript: ENSGACT00000007961
Sequence length 732
Comment pep:known_by_projection group:BROADS1:groupVIII:5905427:5918054:-1 gene:ENSGACG00000005999 transcript:ENSGACT00000007961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGCSLKTLTAALCCFYHKNSVMTAKFSRDQFIVDCPSEKLRKELEEELKMNCEEPRSH
AWYHGAIPRQVAEYLVQRDGDFLIRDSLSSPGCYVLTCQWRNAAQHFKINKKVVMLNEAY
SRVEYRLEREGFDNVPALIRYYVGNRKSVSQVVGAIIFQPINRGLPLRCLEEKYGLSSHR
RDALMAQERRSRKRLSLNVTNGHAQDDARGAQNGARGRGLRFKDRCGSQPASLNQVPERR
RPLQAHQSESYLPLGSKPQRSPDPLLPSPSPKSPVFRTGSEPVLSPSVPRRPAELLAGQA
IRGSDSQLCPKPPPKPSKVPLARPPAPPPGAPGLTHATSGSNAPALASACVQTLASPRSS
EGINSEIVYSASAGPPVPPVKPLKFLHQLRPEDTRGFSTSALSPTENGWKRSRFQRPVEE
TESAFQPAQFGSRLLPPENKPLETVVLKRAKELLLSHDHHSIARHLLLADCQVARTVGVT
PEVKGQMGVSSGLELVTLPHGRQLRLDLMERHHTMAIGVAVDILGCTGSVDERASTLNRI
ILVALELKDAVGDLFAFTALMKALDLPQISRLEETWTTLRRTYTQTAISYEKTLKPFYKN
LYEGTASSPAVVCVPLLLPLLTLMERPSITPEGAELWETSDQGCDIMLRHLEDARDVAHN
AQRYTINSQMILEGFPCDEDLLEVFKTDFQLRLLWGSRGASVNQSDRYNKFNLILTALSR
KLEPPPNTQIVI
Download sequence
Identical sequences G3NRH5
ENSGACP00000007942 ENSGACP00000007942 69293.ENSGACP00000007942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]