SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008009 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008009
Domain Number 1 Region: 290-402
Classification Level Classification E-value
Superfamily SH3-domain 4.24e-21
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 93-163
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008009   Gene: ENSGACG00000006049   Transcript: ENSGACT00000008028
Sequence length 409
Comment pep:known_by_projection group:BROADS1:groupV:8032461:8049138:1 gene:ENSGACG00000006049 transcript:ENSGACT00000008028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEISEKENEPQNLHRPPPATVPSPPETKLQRLKRSLSFKSVMRSKSVDNFFQRANGESR
PPPALIASPPRPQSPPRSPSPPGLGAPPSHPLVAQPRPLVHLAPARTHCFQEHVITRGST
CEHVFGVNCPVSPGNSKQGLRCKACKLPAHLWCSSELSQQPCNGKTGAFKRNFSSPLLTS
DALGVVVEAPASQDAAEADNGTVDPVYEALRYGTSLAHMSRSSFSSISESPCHELWQAEK
LQDKLENQPIAEEEHIPGKRTRPPVLTPPESEKADSEDRVSLKQTPKKVEVHSIHTYVAL
YKFLPQEKNDLELQPGDRVQVTDDSNEDWWKGKSRDRAGLFPANFVQRVRPGERVWKVSD
GFHGNRDKGQMTVKEAQICVGKNEEIDGFLRLSSGKKRGLVPVKNLLEI
Download sequence
Identical sequences G3NRP2
69293.ENSGACP00000008009 ENSGACP00000008009 ENSGACP00000008009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]