SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008098 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008098
Domain Number 1 Region: 257-419,520-773
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-102
Family Ras GEF 0.0003
Further Details:      
 
Domain Number 2 Region: 427-529
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.76e-26
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 1-97
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-19
Family DEP domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008098   Gene: ENSGACG00000006108   Transcript: ENSGACT00000008117
Sequence length 774
Comment pep:known_by_projection group:BROADS1:groupX:8815409:8840688:1 gene:ENSGACG00000006108 transcript:ENSGACT00000008117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRSYVGVELVQWLCEQCVYVRCRTTGVRVWQVLLELGVLLSVDQRVMFSDSNSYYQFSFE
ECDSASCDFRSNEGEWPEAVRLLLQLAPYIQFRSGGGANSPHPRSEEDSEGNRDICSEML
QIQQVQNELAAALARKTRKALSEQDSESTDTSQQEPQTPSEESSPGTGTVCGREELTGRL
GLEAVQRLAKDGCRLLQNHNYRVPDRTQADNEAVGRVCLKERGRDVLVLRRVTSSVTSPS
DRPSPTSSGGGSREEDCDKRYVVVSGTPLKILEHLLSDLRLDDQRGAPECRESETLLDDF
LLTYLVFMSTNDLCQALLGQYPSDRCRGQEEGKDALFRKRKVLQLVSHWSRLYKDFLKEE
EHVRSFMKTLYRCVLEDLYEFPTLEKDLKEFQKLLRRRHTVDDCPPNQKSKQMYQQLSLK
ENCLQLRSPPSETKEVICCVHVSADSYLSVHTHHSLEGHELLRIVGQKMDRAEEDMVLAV
ASHTGERRVLQPSDCVYSESMTPQGKLVACRRDLTEILPPLTDSAELSRRPVRLLGINTC
DVAAALTHLDWSLFKSIHEQELAYYTLSRVPGTGHTAALSVLLQRCNEVQQWVMSEVLMC
TSLNKRVQLLKKFIKIAAHCKAQRNLNSAFAIIMGLNTAAVSRLNQTWEKCPGKFKKLFS
ELELITDPSLNHKAYREAFKKMKPPKIPFMPLLLKDITFIHEGNKTFHDNLVNFEKLHMI
AETVRMIRHCQSDQPGNEVIGVDSAEVRASVHYLHIIDNQQTLFELSHKLEPRA
Download sequence
Identical sequences G3NRY1
ENSGACP00000008098 69293.ENSGACP00000008098 ENSGACP00000008098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]