SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008104 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008104
Domain Number 1 Region: 69-327
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-87
Family Protein kinases, catalytic subunit 0.0000156
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008104
Domain Number - Region: 353-394
Classification Level Classification E-value
Superfamily UBA-like 0.0123
Family UBA domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008104   Gene: ENSGACG00000006112   Transcript: ENSGACT00000008123
Sequence length 1230
Comment pep:known_by_projection group:BROADS1:groupI:2247753:2267649:1 gene:ENSGACG00000006112 transcript:ENSGACT00000008123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVSSGGAAGSAAAGITHSARPTHAGMGSQNRAQPSSGINHPSRTGTAPGSIASPGHTS
ATRPPPARVGHYEIERTIGKGNFAVVKLATHIITKAKVAIKIVDKTQLDQQNLKKIFREV
PIMKVLEHPPIIRLYEVMETERMIYLVTEYASGGEIFARTDHLVAHGRMAEKDARKKFKQ
IVAAVHFCHCRNIVHRDLKAENLLLDHNLNIKIADFGFSNLFARGQLLKTWCGSPPYAAP
ELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTDCE
YLIRHMLVLEPSRRLTLEQICKNKWMRLGDPDPDFDRLIAECEQVKTEREVELINEQVLK
AMCEMGLDRERTLQSLQTDAYDHYSAIYSLLADRLKKHKTLLVAPPKPRSINYPLSAVQG
NPVSMTVPHVQLINPENQIVEPDGSMALDSDEGEEPSPEAMARYLSMRRHTVGVPDQRTD
MQEDLQKLPPGFPRGAVPQPPFPSLVPNMGQTHTLMPAQSLQPTQQLEYKEQSLLQPPTL
QLLNGMGPLGRRASDGGANIQLHAQLLKRPRGPSPLVASPHPIPAVAPVDEEGSDGEPDQ
EAVQRSSYKDCNTLHLPMERFSPVRRFSDGAATIQAFKAHLEHSSLIKQLKQECEQLQKM
YAAQQDERFLEHTQQQHILYQQEQQILHQQIQGLSLGHGESQPSHLTHQLQRLRIQPSSP
PPTHPSNHLFRQPNQSPPPCSAGMMQGHGGPSPVQYQHGAPALYQGQSGSPPPRASLPTN
QQAASAHPSVALAQGVPQQQQVTIQVQEVELGGVAQRQGGFLSTPGHRVLGKQLSADNAE
THSRSLGRFTSAYDQAHFNPHLFSGDVASRVVGPYNHYLQGASLNVPGLEEYQSGAVGTG
TYGPPSALQQALLSPTPFECRPAQHHVTPTLQGLLSPRHSLTGHADPRLPPQDLAALLKR
QSPRPCPSTPALPSGAPQEYGEILVLRQLNQGEGLELQAPQGAAGGQHYHHLLQIRPPEV
QPQQHLAQAPCPGLPHSESMEEDEAPPGYPHPHEGLLAKAADGHELLGPPLGGTPPYNSP
THRHGGYARNVPPARESEHVDCRPQGQAMEVPDHNGVGYSAAPQSDAYRSRGQLQRHHTI
QTCDDAYDQAEPMSGMSLLAGKALSSARMSDILSQTSLTGSQQLHQRGESACDVEEELHA
AACYPSSCTSDMLLSYKPPDLQYSMEQAGV
Download sequence
Identical sequences G3NRY7
69293.ENSGACP00000008104 ENSGACP00000008104 ENSGACP00000008104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]