SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008111 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008111
Domain Number 1 Region: 96-214
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-16
Family Second domain of FERM 0.0052
Further Details:      
 
Domain Number 2 Region: 219-317
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000301
Family Third domain of FERM 0.0037
Further Details:      
 
Domain Number 3 Region: 3-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000176
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008111   Gene: ENSGACG00000006129   Transcript: ENSGACT00000008130
Sequence length 325
Comment pep:known_by_projection group:BROADS1:groupV:8077155:8079346:1 gene:ENSGACG00000006129 transcript:ENSGACT00000008130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKRVCIFLPDEQNLDCAVRATARGREVLNLVLRQLGVSDLQVFGLAVLRDNEYLFLDLEG
KLSKYFGNLWNRGSVMVSCCQVPFILFLRVQHYVESGRLILSSKVQQLYVAELRRKVLRS
ESRHQEVLFFQLAASALQAEVGDVEHRAEEEDDVEGKEKRHRQYFLPEDYFPPWLIKRRG
RDFLLQHGPALHVELRGVTRSQAALQFIKEVSNLQDGPVTFYRMKQEKKEPRRSILLGVT
LKGVHIYQQKDLEGKLCLLYDFSWTDIDRLTFQGSRFEITAVGSLCLPKLVYYTPSAFHS
KHVMRHLSDSHRLHISTRGVVSYVQ
Download sequence
Identical sequences G3NRZ4
69293.ENSGACP00000008111 ENSGACP00000008111 ENSGACP00000008111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]