SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008159 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008159
Domain Number 1 Region: 700-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.11e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000582
Further Details:      
 
Domain Number 2 Region: 509-696
Classification Level Classification E-value
Superfamily ARM repeat 5.32e-64
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 106-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.94e-47
Family Ras-binding domain, RBD 0.00099
Further Details:      
 
Domain Number 4 Region: 331-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.23e-39
Family PLC-like (P variant) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008159   Gene: ENSGACG00000006156   Transcript: ENSGACT00000008178
Sequence length 1069
Comment pep:known_by_projection group:BROADS1:groupVIII:6364215:6377038:-1 gene:ENSGACG00000006156 transcript:ENSGACT00000008178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHDLFKEARKCPLHQ
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDASGPHSRALYVYPPNVESTQELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLGRLPNLMLMAKDSLYSQLPTD
NFVMPSYSRRISTATSYMNGEAAVKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SSSVKYPDMNAVEDHANWTISRELGFSYNLSGQSNRSARDHALTESDTEQMRQLSNRDPL
SEITEQEKDFLWRHRHYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKEWPSIRPEQAME
LLDCNYPDPMVRHFAVRCLDKYLTDDKLSQYLIQLVQVLKYEQYLENPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKEVQMRFLVDQMKRPDYMDALQNYTSPLNPAHQLGNLRLDECRIMSSAKRPL
WLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCL
SLGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNKGEMYDMAVDLFTR
SCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGSQECAKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALEKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
Download sequence
Identical sequences G3NS42
ENSGACP00000008159 69293.ENSGACP00000008159 ENSGACP00000008159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]