SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008289 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008289
Domain Number 1 Region: 215-271
Classification Level Classification E-value
Superfamily SH3-domain 1.13e-19
Family SH3-domain 0.00067
Further Details:      
 
Domain Number 2 Region: 54-109
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000148
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0072
Further Details:      
 
Domain Number 3 Region: 276-331
Classification Level Classification E-value
Superfamily SH3-domain 0.00000486
Family SH3-domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008289   Gene: ENSGACG00000006271   Transcript: ENSGACT00000008308
Sequence length 333
Comment pep:known_by_projection group:BROADS1:groupXII:7677172:7682129:-1 gene:ENSGACG00000006271 transcript:ENSGACT00000008308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQEDDKNSVDIHDNPPAPENVVREEGDTVYFIYDEEVEVEEKEPEPPPPVVRINDKPHK
FKDHYCKKPKFCDVCARMIVLNNKFALRCKNCKTNIHHSCQSYVEFQKCFGKIPPGFRRA
YSSPLYTSDIPDPNNPNRNDPVFDTLRVGVIMANKERKKNENDKKNMMMMMEEEEEENNQ
QPKENEEGGEGKPDDKKEKGGDKADEKSKGTFSQSHYYLALYRFKAIEKDDLDFHPGDRI
TVLDDSNEEWWRGKMGEKSGYFPTNYLIKVRASERVFKVTRSFVGNREMGQITLKKDQIV
VKKGDEKGGYLKVSTGRKLGYFPANLLEEITVT
Download sequence
Identical sequences G3NSH1
69293.ENSGACP00000008289 ENSGACP00000008289 ENSGACP00000008289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]