SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008308 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008308
Domain Number 1 Region: 13-132
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-28
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008308   Gene: ENSGACG00000006284   Transcript: ENSGACT00000008327
Sequence length 243
Comment pep:known_by_projection group:BROADS1:groupXIII:4903744:4904954:1 gene:ENSGACG00000006284 transcript:ENSGACT00000008327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLNERSVAHYATCDSPPDKTGFLLKKGERNTAYHRRWFVLKGNMLFYFEERDGREPIGV
IVLEGCTVELCESAEEFAFAVKFDCAKARVYKMSAESQAAMESWVKALSRASFDYMRLVV
KELERQLEEIHEAGVGVGGPQGRPKTARPNQVARSRSGVSSSSLPWRESLQEDVQLTSDS
SKENGDAWSRPPPVAPPVPPRRRGASLESPVSPGTDCFSKLHDWYGREVEELRTQWLHSH
ILP
Download sequence
Identical sequences G3NSJ0
ENSGACP00000008308 ENSGACP00000008308 69293.ENSGACP00000008308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]