SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008314 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008314
Domain Number 1 Region: 179-303
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-30
Family Pleckstrin-homology domain (PH domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 340-443
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-24
Family SH2 domain 0.0000324
Further Details:      
 
Domain Number 3 Region: 29-86
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.83e-17
Family Adapter protein APS, dimerisation domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008314   Gene: ENSGACG00000006289   Transcript: ENSGACT00000008333
Sequence length 585
Comment pep:known_by_projection group:BROADS1:groupXIII:4920356:4945861:1 gene:ENSGACG00000006289 transcript:ENSGACT00000008333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGNTIHPANTTNTTAARGGGPSVAAPPRGWREFCELHAIATARQLAGHYRIFARERPQH
DALPPETFSKQFTDLFQQHFSCEVDKDGALLGQDYREAGRPGGEAAPSGVGSPKLEPVVA
SREQEQQQQPLGCSAVSQIRQTVWRLFQKRPSPLSSQDLAPSNPNLPTNSPPIPPLVQAL
RPRPQPPRTCKEGQLRYLLVEDAISDTQPRWQRCRLLVRRIRGGGGERYQLELYDPPKAS
SPKLTTPCSDIQEVRRCNRLEMPDNLNTFVLKVNQGSLIFETDNDQQVSSWTTELKECIN
NRSGSVDLEPLPSPADSGAPANRRGSSEPGSQSTATFALPEQVAQKADHFLFSYPWFHGP
ISRVKAAHLVQSAGPQGHGVFLVRQSETRRGDYVLTFNYQGKAKHLRLSLTEWGQCRVQH
LRFPSVMDMLSHFRLFPIPLECGAAGAVTLSSFVVAGSSPPSQGQLSGAHLIPFSLHRWS
SEPSLAHCSLARSASQPRSTCPSSTSTSSSPGSVPPPANRPFPRTNRVPDAPLTAAAPLR
RSESAGRRPLLPRHPITNIPQRDSDYELEPERGHKRAIDNQYMLV
Download sequence
Identical sequences G3NSJ6
69293.ENSGACP00000008314 ENSGACP00000008314 ENSGACP00000008314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]