SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008322 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008322
Domain Number 1 Region: 148-456
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-96
Family Protein kinases, catalytic subunit 0.0000000000519
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008322   Gene: ENSGACG00000006296   Transcript: ENSGACT00000008341
Sequence length 460
Comment pep:known_by_projection group:BROADS1:groupI:3039163:3045850:-1 gene:ENSGACG00000006296 transcript:ENSGACT00000008341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEVSVVREGWLHKRGEYIKTWRPRYFILKSDGSFIGYKEKPEVSSDHSLPPLNNFSVAE
CQLMKTERPRPNTFVIRCLQWTSVIERTFHVDSNEEREEWMRSIQAVANSLKSQQHDEEP
MEIKFGSPSDISGSEEMEIAVSKSRTKVNMSDFDYLKLLGKGTFGKVILVKEKATGMYYA
MKILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTTLKYAFQTNDRLCFVMEYANGGELFF
HLSRDRVFSEDRARFYGAEIVSALEYLHSRNVVYRDLKAQLENLMLDKDGHIKITDFGLC
KEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHER
LFELILMEEIRFPKNLAPEAKALLAGLLKKDPKQRLGGGPDDAKEVMIHKFFTSINWQDV
LEKKLVPPFKPQVTSETDTRYFDDEFTAQTITITPPDKCE
Download sequence
Identical sequences G3NSK4
ENSGACP00000008322 ENSGACP00000008322 69293.ENSGACP00000008322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]