SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008327 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008327
Domain Number 1 Region: 1419-1601
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-39
Family DBL homology domain (DH-domain) 0.0000814
Further Details:      
 
Domain Number 2 Region: 1611-1725
Classification Level Classification E-value
Superfamily PH domain-like 3.97e-33
Family Pleckstrin-homology domain (PH domain) 0.00052
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008327
Domain Number - Region: 915-1057
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00307
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 691-826
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0419
Family CRAL/TRIO domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008327   Gene: ENSGACG00000006294   Transcript: ENSGACT00000008346
Sequence length 1803
Comment pep:known_by_projection group:BROADS1:groupXII:7728140:7741156:1 gene:ENSGACG00000006294 transcript:ENSGACT00000008346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSLDSVEGSIRYLLSGLYAPFEATAPTLLSQLFQIIDSRYRGDALRCLLDFLVPAKRILE
TVQQAACARYSDVLFPCEGWPLCLRDRVVVHLAPVNPSLLQPGDFYLRVAPFCNQSARIL
VCSLLEEEGLTVEAVEEAPIVDTSYPCLFTCDWLEEINQGRHGRPLSQCLLASEQGVVRL
PWERVAAPDFVDVPLVSSSNSSHPLSPKTPSPKQHPVTSSTASTSSHPSAFSVETRICPA
RHGIAVSLCLVDTSGASSSRLVTVKETGSEPKPIGWVSPNTWDSCCRTVAEGEYIDILQA
TMLFRTTQIRNAIACRNQPANAKCVRTVRFSEKPCTPCMRRRQGAKASKSQELRCRFRDS
YQAAIQNPVPFGQEKDRGNMLAVVEEGGDFSHWEKRALETNAGRKVPGTRFDSGMQNMSP
SSVSGALGKESGEKNTVPYWKTGDTNAAPCKDYRGTYVSKVGGPPEQTAERTTVHFREPR
DSHNVNGTSLNDPNQSDATSAKHHQLPLTSTDGLEMKMTLKPRERLQSRNNSKGVGPNFP
QSLSAPQSRHEFISDGRCSSLSTAVVDTSEKCALVIVEGQSVRRRDDTGSCAEIPQLHVV
KCKNSTAFGLVSPKINRKQTVVPDAAQPGRKFITSRSGHQVENPSQSDPPAATETRKVSA
PASSRPRPDHLPLGSPDPRDQPLYLGVASITGGRDRTGRAIVELYGHHQGWRSSVTSQEL
LQMLLYFRTITRREIREAGLMLIFDSRRTNPQPQLYKALMTFQEQNPHAVNCFVLLVNRE
NSLRPERCPGIQTEVVTSMKGLFKLVEMSQLSSCLGGTLPHSHSDWIELHQKLFPFVSDL
HEAASLLLRAITELEEPQGTDTVQTVQQCMMDQRTLMRHVLEDSRLVSLQREGGAILARL
RKESDLKYPHCENLSDAVDSVTSMYNQVEEQAHVLVQRSNMSLEHLECLLELREVEGHLM
QMQQWFHIEGERHLLEAESVSNSGEQMEQILNSFTGFLIEANDRRHHAMTLVSEAERLQQ
SGSQYTETEAFGDLVSTFRSGLESFLVRAEACGRELQIMVNVCDFCEQATALASECIEYL
DQTQPIIRDPTTTPPSTDTSVLQAFQDTFLQFSMERFQEVKAQAGALQGSRGMQVWNVAW
LRCREARQQLHERMQGVEDVSQHQADSSSLCELHYVDVVSTNVQSPSSGGRNLVVQSTPG
PGHPQWEGIVSGAVDVGKRRPILGRNNTTSTNAACCNVTSEDHSDAGTSQGSNVTPQSPQ
RIFPSYAFMSFNDRSARRTEGEARRRQTSRARSERDAAALSQSHTVGCQWFPWGRGLRAR
SASQDSCSTGEATPPEQPLRPPSSCSHHGQPSCRILQEAQKFQISRHGSFCSTESCTSDG
GAAGGNRTPYCKHASLPAGRCEEAFCLATPQENASNALRLQRVMEELVFTEREYVRSLGY
ILTHYLPLLDRPDIPQDLRGKRGVIFGNLEKLYDFHSHYFFPELEACQREAGMVARCFLR
HSESFGLYALYSKNKPLSDALILHRRHDIFKKKQQELGDMMDLSSYLLRPIQRISKYSLL
LQDMLGSRAADPTSIEPDRERAEIQAAADLVRFQMRHGNDLLTMDAIQECDVNLKEQGQL
VRQDEFTVFFRKKKCVRRVFLFEDLVLFSKTRRTDIGNDVYVYKQSFKTSDIGMTHNSTV
NSLSFEIWFRRRKRQDTYTLKASSMEVKKVWTTDLERILWNQATHSRELRMQERVFMGTG
RKPFMDIQPSDAAISDRAVSCAPPGRNRSIDYPRPHSVGSGSTASTNLSQSSSSSGRGSL
PPA
Download sequence
Identical sequences G3NSK9
69293.ENSGACP00000008327 ENSGACP00000008327 ENSGACP00000008327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]