SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008334 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008334
Domain Number 1 Region: 186-457
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-81
Family Protein kinases, catalytic subunit 0.00000000052
Further Details:      
 
Domain Number 2 Region: 12-113
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-17
Family Pleckstrin-homology domain (PH domain) 0.00000255
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008334   Gene: ENSGACG00000006298   Transcript: ENSGACT00000008353
Sequence length 476
Comment pep:known_by_projection group:BROADS1:groupXV:2709167:2719012:1 gene:ENSGACG00000006298 transcript:ENSGACT00000008353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFEVAIKQSATVHHRREYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQC
QLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEEREEWTKAIQAVAEGLQKQEEEMMDS
SPDPMDMEIYLTKPRQKVTFNSNAYSSQSLPSPPPLTPQLLFQTSAAGDLAPDSVSTGFL
IPTCVDEVAHTLTENRVLQNSKHPFLTGLKYSFQTHDRLCFVMEYANGGELFFHLSRDRV
FSEERARFYGAEIVSALDYLHAERNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILME
DIRFPRTLGPEARSLLSGLLKKEPTQRLGGGSEDAKEIMQHKFFAGIEWQDVYEKKLVPP
FKPQVTSETDTRYFDEEFTAQTITITPPGQDDSMESFDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences G3NSL6
69293.ENSGACP00000008334 ENSGACP00000008334 ENSGACP00000008334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]