SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008415 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008415
Domain Number 1 Region: 84-291
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.5e-58
Family DBL homology domain (DH-domain) 0.0000306
Further Details:      
 
Domain Number 2 Region: 276-327
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000063
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008415   Gene: ENSGACG00000006362   Transcript: ENSGACT00000008434
Sequence length 327
Comment pep:known_by_projection group:BROADS1:groupXV:2755530:2761304:-1 gene:ENSGACG00000006362 transcript:ENSGACT00000008434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPEGDGERPLSLASTLSSGSSRDSRSLFGSTAALPSSATPPEQSEDDIDLELSPAEPEPA
PDHHRNGDGKARFPASPVVARAMAPDPKLTYLDRVVMEIIETERMYVKDRSIVEDYLAHI
IDMSNLPIQPEQVCGLFGNIEDIYEFNSELLQSLDMCESDPVAIARCFVDKREYFDIYTQ
YCTNYPNSVAALTDCMGSKTLATFFQDRQAALKRSLPLGSYLLKPVQRILKYHLLLQEIA
KHFDSDEEGYEVIQEAINTMTGVAWYINDMKRKHEHAVRVQEIQSLLINWKGPDLTTYGE
LVLEGTFHVLRAKNTRTLFLFERMLLI
Download sequence
Identical sequences G3NSU7
69293.ENSGACP00000008415 ENSGACP00000008415 ENSGACP00000008415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]