SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008447 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008447
Domain Number 1 Region: 374-425
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-18
Family B-box zinc-binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000177
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008447   Gene: ENSGACG00000006386   Transcript: ENSGACT00000008466
Sequence length 427
Comment pep:known_by_projection group:BROADS1:groupXV:2790163:2792731:-1 gene:ENSGACG00000006386 transcript:ENSGACT00000008466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNRCYCCASKFSLFKKELGCKSCGRSFCSGCLTLSAVVPRCGNTQQKVCKQCHGNLTGG
ESPNDAGKWSPPENYKKRVAALEAKQQGQSTQPSAQGGSRNNKACQLPTKGLSKEDRAIA
ERLQKLKEDTAPKSVPSDKELESRLAALKAPTRPVPSAEEMEKRLAVLRGETPPSQAPVH
KPPDNRTQTEQANDLITQMSEEVAIDDQQTDPECSVDSRMNDLNKGEGGTLDENLEENQQ
GDKQLEAEKAQVMEEAMEELRKERHSQDQILNMAKRMAQLKGRDPDKVTMEDFQQPDSEE
ETEEEAVKRVLKQLSEEAALDEASGYNIPLEPSGPKNTEMKKQSKTQSQAPAPKSKISTA
AVAHQPSDSDEEELPWCCICNHDATIRCHTCDEDLYCHRCFREGHDKYDRKEHRTTNYTA
PKKKRKT
Download sequence
Identical sequences G3NSX9
ENSGACP00000008447 ENSGACP00000008447 69293.ENSGACP00000008447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]