SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008461 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008461
Domain Number 1 Region: 40-378,402-514
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-94
Family Ras GEF 0.00039
Further Details:      
 
Domain Number 2 Region: 619-714
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.94e-35
Family Ras-binding domain, RBD 0.0000771
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008461   Gene: ENSGACG00000006395   Transcript: ENSGACT00000008480
Sequence length 714
Comment pep:known_by_projection group:BROADS1:groupXI:2801007:2809187:1 gene:ENSGACG00000006395 transcript:ENSGACT00000008480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPVQEWGEEFEDGAVYGVTLLREPVPSSPDPSEESACCAFVQYRTCKVRRLKAATLELL
VNHLLGPGTQEQDYSRIFLSTYRTFTGTSKLIELLFQRYLFSSSPNRDNIVSDLDNSESY
TSLLSPLLAFVQTWLDDYCEDFRDPPLHPALRLLLDHLRISSAVYNNMRSQPNFSSLAGQ
AEELLKRLQQKQDMEQDEEVTDDEDSGLEVSHDPGGILDFPALAIAEQLTRKDSALFVKV
MPYQCLGCVWSKRDKKENMSPTIRATVTQFNDVTKQVTMSLLCQPADATSSPTSSRRPPT
TPAHRARIIEKWICVAQDCRRLKNFSSLKAILSALQSNAVYRLRKTWAAVSRDSIAVFDN
LWQTFPDENCVLTNRELLVEDGGQANVDKTSPKTSKRCPIQRQMSTCSGVVPYLGTYLSV
FNMLDTAHPDTVRGGLINFEKRRKEFEVLSQISVLQACCSQYNLPHSPGIAAWLRGHKLL
SDQESYELSKQLEPPLDLCSPTPWSHRALSKKLSSTFFVLSLLTVSDGPKKVCADEISVS
SSGSSGSETEDLSLSTLVSSDELTRCLRPKGRSCSAQRPIIYSSQGLVYSSLFPRSKCFH
SSCNNVSEHHKRSASMTSLPVYNRQVADSCIVRVSVDLGHNNGNMYKSILLTSQDKTAQV
IVRALEKHHLEHMNWQDFTLTQVISTERELLIPDKANVFYAMSTLANFDFVLRK
Download sequence
Identical sequences G3NSZ3
69293.ENSGACP00000008461 ENSGACP00000008461 ENSGACP00000008461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]