SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008493 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008493
Domain Number 1 Region: 310-649
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.22e-128
Family Mammalian PLC 0.000000000656
Further Details:      
 
Domain Number 2 Region: 143-305
Classification Level Classification E-value
Superfamily EF-hand 3.27e-45
Family EF-hand modules in multidomain proteins 0.00000377
Further Details:      
 
Domain Number 3 Region: 11-141
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-41
Family Pleckstrin-homology domain (PH domain) 0.0000055
Further Details:      
 
Domain Number 4 Region: 872-1128
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 9.81e-32
Family C-terminal domain of PLC-beta 0.0000414
Further Details:      
 
Domain Number 5 Region: 668-786
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.06e-21
Family PLC-like (P variant) 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008493   Gene: ENSGACG00000006413   Transcript: ENSGACT00000008512
Sequence length 1151
Comment pep:known_by_projection group:BROADS1:groupXV:2822813:2836904:-1 gene:ENSGACG00000006413 transcript:ENSGACT00000008512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKKRYFLEPPEVKDYLVKGERFTKWSEDSTKTVPVTMKMDPKGFYVYWVNQSKETTFLD
VATVRDTRTGKYAKLPKHTKVRNVFNMDFPDSNHLTKTLTIVSGPDTVNLTYHNFFASKD
KVSQNWANDILAIAYNAARNNACRYVFLEKIYTRLSLHTNKDGKIPVKNIYKMFPADKKR
VESALASAHLPKGKFDTIKSDVFTESAFKLFLQNLCPRPEIYEIFTSYSNKPTMTRENFT
KFLNEKQRDSRHNEELFPRLRQDQIKALMDKYEPVSSNSNRNLISPEGLLFFLMGPETSV
VMQDTLAKSQDMTQPIPHYFIKSSHNTYLTAGQFSGVSSPEMYRQCLLSGCRCLELDCWK
GKPPEEEPIITHGFTMTTEILFKDVIEAIAESAFKTSQYPVILSFENHVDSVKQQEKMAN
YCKTIFGDALLTDPLDKYPLKPGQQIPSPSELMGKILIKNKKGSHEKPAQTKKTSTGATD
PTATTASPTQDQGETAVEDAEEQEDTEEQDEEKMKTSDEGTAGQEVTAYEAMSSLVNYIQ
PNKFVSFDNARKKNKSYVISSFVETRGEAMISKTAVEFVEYNKRQMSRIYPKGTRMDSSN
YSPRPFWNVGCQMVALNYQTMDFPMQLNMALFEFNGRTGYLLKHDVMRRTDKKFDPFCDR
IDTVIASTLTIKIYSGQFLSDKSVKTGVEVELIGLPGDPKKKYRTKWSTTPNAINPVWNE
EPFVFEKILIPEMASLRIVVHEENGKFLGHRIIPLDAIQSGFHHICLRSESNMPLTLPAL
FVYIEVKDYIPAAFADFTDALFNPTKDAAAPEKEAAREPEAPPAVTEEPANDPPAAPLPA
ADDATGPEAAGGPVAVAPPGPASAPAESVGSAAEPSTVAAEELTQHKAYLKVVKRQERDL
KEGEKKCQKKVEDLIQKYSDTFKTMKKKASLKKKESCHVSSRGGGSTFDPERVQEQKEKM
QVELQDLWTEQVDHLKKRKEHCATERLAKLLELAAERHAAELKTLEREENKKKTRSSSGK
AKNEPKRGMKPFMHLSTCSHPPPDNKRRVHNHSPTRPRTNTHLLFTEASDCSPQQVTLVK
KQAATLEEIKALTNQLNNEALQEHHQKLRALPAEVKQAVSVCVGAHFPELVDQAGDTKVE
GAAGYADVFLG
Download sequence
Identical sequences G3NT25
ENSGACP00000008493 69293.ENSGACP00000008493 ENSGACP00000008493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]