SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008515 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008515
Domain Number 1 Region: 490-601
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-30
Family SH2 domain 0.00000249
Further Details:      
 
Domain Number 2 Region: 175-264
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.92e-27
Family Ras-binding domain, RBD 0.00015
Further Details:      
 
Domain Number 3 Region: 296-410
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000466
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008515   Gene: ENSGACG00000006438   Transcript: ENSGACT00000008534
Sequence length 605
Comment pep:known_by_projection group:BROADS1:groupXX:6202336:6235349:-1 gene:ENSGACG00000006438 transcript:ENSGACT00000008534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAGCPDYFLHHPNYQQDNIDRSSNHIQADIIGPNFQQSANRSSPNHQDDDVDLEALVN
DMNSSLESLYSTCSGQQTESTPLLHNGQSSSSHQLHHHPHHTQLNQPRQDLSHRSLRRSQ
PMHILAVRRLQEAEQQLRTSSLPAIPNPFPELCSLANSPVLSPGSLPPGEPSTGIYIVKV
FSEDGLGKVVEIPAGMTARDLCQLLVYKSHCVDDNSWALVEHHPLLGLERCLEDHELVIQ
VQASMSSGSRFLFRKNYAKYEFFRNTHTFFPEHMVAWCQETNRTIPPSQLLQNFLATSSC
PEIQGYLYVKDVGRKSWKKVYMFLRRSGLYCSAKGTSKEPRHLQFLADLEDSSIFTVITG
KKLHGAPTDYEFCIKKPNKCRGESKELRMLCAEDEQGRTCWMTAFRLFKYGIVLYQNYKI
PLQRKTLLSHFSAPVRSVSENSLVAMDFSGRIGRVIENPLEAQSAAMEEGHAWRKRSQRM
NVLGSHSPLHHSSLSSVIHIAQMWFHGRITREESHRLIHQQGQVDGLFLLRVSQSNPKAF
VLTLCHHQKIKHFQILPCEEDGQVFFSLDDGATKFTDLIQLVEFYQLNRGVLPCKLKHPC
TVVAL
Download sequence
Identical sequences G3NT47
ENSGACP00000008515 ENSGACP00000008515 69293.ENSGACP00000008515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]