SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008527 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000008527
Domain Number - Region: 147-215
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0241
Family Ubiquitin-related 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008527   Gene: ENSGACG00000006446   Transcript: ENSGACT00000008546
Sequence length 1330
Comment pep:known_by_projection group:BROADS1:groupXX:6253039:6282798:-1 gene:ENSGACG00000006446 transcript:ENSGACT00000008546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHVKKTLFCVCPRRRMKARAPAPPQAPLPAPRHIFRNVGPDGGGTSAMDTKENMLRPTVD
LQLTLPRGNQTSVTEDGRHAAWDHAVELCSRQHLNPGTAHPELLSPEGHSLGFKPNAPLG
SLDVACVLIKEKVWEDRVVRRPAPKVPEKTVRLMVNYHGSQKAVVRVNPFVPLQALVPVI
CDKCEFEPAHVLLLKDGISHHELPLDRSLTELGIKELYVHNQSLDSISSSTNSLNRAEKK
GLLGIFQFSRRKNRKNKYKTIKGLVNKKNQPVTAISSSRVNGLSTASGVLSVEDRPSTLG
QSQSVMNISRMSPKAETKKRRAPALPAATTATTSKLSEKMGLGSESQQRKRKAPAPPPTS
RSESETALNVKLDDVENNRHSAMGATDQPAPPKPRRTAARDPPHLVLPPTLPSPSIAPTE
SNSPEEAGEAGPQSRTAELKPETETPEEETVSLGSGGSSLPDQGYAASEGMAEGEDSGIV
SCPSETQPTSPDGSLSQGGRSAGGGRLSGPMRDNSSDSDEKRCESRAWPDAAGSPLIQAK
SGRLKGHYEDDPELTAQLHQTLADFEADLAGEANWHHIDIASSKNTPYTLSTDSNEVPVS
VVDMDVPVTAIDEIQPFPSDPGQSSVKTQNQNNNACTAADRNKSSSANNKQPSRPKQQRT
PLEDKSKADKKEKKMPGTKMKEMITTDSSSVKEQRATSAVDPRKLSRDAEVKRDLVKGNA
QSLQEKKSVVPPTSQRPFSPGATEETHSVHPNNSSPTGKITRNVPSRFGMKTFTVVPLKP
AVVHAATGQPADKLTIGAIKIDDQGNMVKGAVSRNKVGGSSESSINSSEGSPLLGKAKAF
WSSSERQENHLPRCSSTDGLKGPSPAISVATLKASNAEDQKITQNSFYKQAEKIQMVKEE
AKEPVRAVKVTKEERVEAESKITVSKSVQEPNPKKDLSFLKPSRQTSSQYVASAINKYTP
KHHMRPSAKPSHVPNVQASSASLRLQTFDFQRSGPSIKVNPHQSSQSSLSDSPRDLGEVR
SDTGRFGSGTGSTKGSSNTLETETALNKHIQSGGPTQRNTFASNDSNGFKQIRLRSSSPA
QSSTLHSSPKPPTVLQTVSQGLASVSKICLANISCRKKNKKDVTSAAGHLTPDAETQPSV
TVSEKAVTPGPLPPTLFGPVQKFRPVISRSVDKDTNLHSSLMEAIQTGGGRDRLKTITST
GLSSMKKASYVEEENERSALLAAIRAQSSSGRLRKTKSVVANELEEERGAIPPPPPPSFT
GTVVPLPPPPPLPIIAPPPPPPVLPLAKSSTVGHRGATSPTDAALARDAMLEAIRSGSAA
ERLKKVQIQE
Download sequence
Identical sequences G3NT59
ENSGACP00000008527 69293.ENSGACP00000008527 ENSGACP00000008527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]