SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008541 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008541
Domain Number 1 Region: 229-448
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-57
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 438-581
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-17
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 588-648
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000407
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008541   Gene: ENSGACG00000006452   Transcript: ENSGACT00000008560
Sequence length 668
Comment pep:known_by_projection group:BROADS1:groupXII:7884667:7893731:-1 gene:ENSGACG00000006452 transcript:ENSGACT00000008560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDGFQPRSPPAAQSETAKPPEDVDRLVVPQQVVLSTMSPAARKVGTRQLIPKNLSSRPKQ
RHHTTVVTFPVGLENSSSGTRSRHSTQGPDVSWEDYDSDGDGFALRRNRRNKSYRAAVTS
LDIDAMASGRGPAATLKPVREDRAVSPGPSRTPGRKRTLGRKRNQHHRGSFKDATPCLYQ
EIRERGLHSTNRDELLDDFVVVEEAPAVEDQGIVVKSYRPAQLTWSQLPQVKDTGILTQI
SAQERKRQEAIFEIITSEHSYLHSLGILVRCFKSSDALKKTMTATDYHHLFSNISVIEQI
SKRFFEDLERRHYENPVIRDISDIVQNHAAHHFEPYIVYCSNETFQQRTLQKLLTTNIAF
KETLKQIEGSSDCGGLPMISFLILPMQRVTRLPLLLDTICQKTPNAAAEYFAAVWALHAI
SKLVTSCNDGAQRMERTEQMFTIQKQMDFGKIKPFPLVSSSRWLKKRGELAFNTEELSIW
RAFSNKSYYLFLFNDVLIVTKKKSEESFVVMDYATLQNVEVEVGEDVEERTSSPVKNSPF
LSFKLRMSKNSEGRAEQICLVAESRVDRARWIVALTEHKQEGVSTCKGGLPQYEATKAYM
PKEPDELGLQQAELVIVMQKEEAWCYGERMRDGETGWFPAACATEITNATAIENNVQRMK
RLRKETNV
Download sequence
Identical sequences G3NT73
69293.ENSGACP00000008541 ENSGACP00000008541 ENSGACP00000008541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]