SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008777 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008777
Domain Number 1 Region: 691-719
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000549
Family Ran binding protein zinc finger-like 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000008777
Domain Number - Region: 11-50
Classification Level Classification E-value
Superfamily UBA-like 0.0281
Family CUE domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008777   Gene: ENSGACG00000006629   Transcript: ENSGACT00000008796
Sequence length 721
Comment pep:known_by_projection group:BROADS1:groupXVIII:4765974:4774816:1 gene:ENSGACG00000006629 transcript:ENSGACT00000008796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSHQIDIQVLHDLRQKFPEVPEGVVSQCVLQNNNNLDACCEYLSQVSPGYLYSEEGN
LSNDPGFDRLRKHMTQLNLGLQSQNVHVAPNQDSPRMNGSRTLAHSLSDGPLQKGQAPNS
DFFPPEPQSAPVQVPASINVFGGMEPTRKPQPPQHLGLYPMGVKGSQQTPRFNPISVTLA
PHIQTGRNTPTSLHIHGGPQTTNSPQGNSIYIRPFVTQCGTTRQNHQQQLQGGRAQYSPT
SQPQQQIYQISHPSPWSGPQHTASSHTSQHQTQSHQTSHVYMPISSPTNPQAPSLIPTGS
QASSSVMPTSMPTISQYNIQNISTGPRKNQIEIKLESPQRSNSTTAVLRTSSGPRSAGVA
TVPTAPLSIGGPGLSRSQPVYISPSPPTAATASSEEAPSVGSRFYISANATSDDSGGRNP
PTVYISANPSLQGPSGARNMGGQVSMGPAYIHHHPPKSRASLGGGGTASSPRVVVTQPNT
KYTFKITVSPNKPPAVSPGVVSPTFEPNNLLSLPSDHHFVEPDPLHLSDPLSAHRERPSE
PRRLSMGSDDAAYTQALLVHQKARMERLWHELELKKKKLEKLKEEVNEMENDLTRRRLER
SNSASQIPSIEEMKQLRCKNRLLQIDIDCLTKEIDLLQTRGPHFNLSAIHNFYDNMGFLG
PLPPKPKGTLSIVITDPGSKIVKPIADQEEDEGLQWNCTACTFLNHPALNRCEQCEFPRH
F
Download sequence
Identical sequences G3NTV9
ENSGACP00000008777 69293.ENSGACP00000008777 ENSGACP00000008777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]