SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008863 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008863
Domain Number 1 Region: 118-283
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-32
Family Pleckstrin-homology domain (PH domain) 0.0000718
Further Details:      
 
Domain Number 2 Region: 49-85
Classification Level Classification E-value
Superfamily WW domain 0.00000000237
Family WW domain 0.0026
Further Details:      
 
Domain Number 3 Region: 4-40
Classification Level Classification E-value
Superfamily WW domain 0.0000000727
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008863   Gene: ENSGACG00000006687   Transcript: ENSGACT00000008882
Sequence length 1276
Comment pep:known_by_projection group:BROADS1:groupXIX:7934480:8006157:-1 gene:ENSGACG00000006687 transcript:ENSGACT00000008882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPLGRDALPEHWSYGVRADGRVFFINDEARNTTWLHPRSAEPVNSGHMIRSDLPQGWE
EGFTNEGASYFINHNQRTTAFRHPVSGQISAENMDFILQEQAQGASMMSKPVGEQLSSTT
ISEASTAITSSTVDTTSKGSRSSGKVHNFGKREQAIKRNPNVPVVVRGWLYKQDSSGMRL
WKRKWFVLADFCLFYYKADSREESVLGSIPLPSYVISPVRPEDHISRKYAFKASHTGMRS
YIYKRSSVIGSQAEHTGMRTYYFSADTQEDMSTWLRAMNQATLMQNNSNTPRTRTKAEQQ
AVPQMNHGNHHKTPGPNATRPGVHEVLLEPRHHATGERCSFHKDAAAMEHATSAAVLEMD
SHASLSSDHVASALPQFDHASASAPVSRAASTLPSGVCTRNGLVSTPSPILEPNGIAAGT
YQRGPAATPPSDTPKQGHRRNTLEQVEQWVKVQKAEHKGPPSRENTLPRRTPPTQHKFPS
IDACQTLPKTPRQSPAPGRLGEYKYAQDRLSHFRLAPDPGPNTVWQLYEWQQRHQYRHGS
PTAPLYTPAPDYPFGPRPPSTVPPSSSAPRSEGPPRCVSVPPSSADLRSRTLSPTRRPHT
PAGRVTVKPGGNRSAVDVPFALSPRRAKSQLLKAATIERRSLPPSGYITHTVSAPSLHGK
TSDDTYMQLKKDLEYLDLKVAGSQTLKESGKAVKVAESDVDVKLSRLCEQDKILQDLEAR
ISSLKEDKDKLEGVLDVSHHQMEQYQEQPAHAHKIAYQQRLLQEDLVSIRAQMSRLYSQE
MAQAWEEFGRLERSVEQLRTALQAHMNHSATPQQEKAEMKRELWRIEDVMGGLSASKANY
KITIDSVQNPERKLVPSGSDPAVPSLSTEVQPPPRSSAPRILAHTLPHSTVPKWVSVLLP
HSRDLLPNRNAHSLPDPAVQAEDDAAPPRPPLPRLCDYEETPPAVPPLPREASVIRHTSV
RGLKRQSDERKRDRESGQHVANGDCKADLRSYLSEPELPGLSQQNAASDEYQYFQSKGPS
GCPLRPNQSDSIASYVTLRRGPGSAAPRERPKSALERLSSPTEAQQPPSGQPRGRMTAEE
QLERMKRHQRSLVRERKRNLSQGERSAVGLSASGVGPRRSSSVFDWQEERLAAEGQSDEG
WSQAKERGRIQSDGWVVATAVPIREVDVEPLDYDLDISRELSKPQKVPIPERYVESDPEE
PLSPEEVEERSRRAQRMKNLLAKSSFRSVRPSAPLDFGELDSALQQQERIMTASHALAAE
ASRKSKLVAGQCTSTT
Download sequence
Identical sequences G3NU45
69293.ENSGACP00000008863 ENSGACP00000008863 ENSGACP00000008863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]