SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008882 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008882
Domain Number 1 Region: 340-445
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.07e-24
Family FHA domain 0.00000717
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.72e-24
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 210-314
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.99e-22
Family Ras-binding domain, RBD 0.00000998
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008882   Gene: ENSGACG00000006700   Transcript: ENSGACT00000008901
Sequence length 836
Comment pep:known_by_projection group:BROADS1:groupXVIII:4873161:4900611:-1 gene:ENSGACG00000006700 transcript:ENSGACT00000008901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDILPKKSQSNGPEKEKDGVIQN
FKRTLSKKEKKKEKKREKEFARIPDGDEHTLTREDGENSCLAAEVYKDMPETSFTRTISN
PEVVMKRRRQQKLEKRMQEFMSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTRDTADFA
VGEALEKYGLEKENPREYCISRVTTPALPSAPRYSQDDKSSKEVILDDAECPLQIFRDWP
ADRGALVFQLKKRPPDYQGRKGRKVDDHGLQGSTSSLPPEKLPYLVELSPDGSDSRDKPK
LYRLQQSVTEVGSDCTEDGAIQLLGPGILPHHCNLMHSEGMVTVTPHGPDADTFVDGQRL
NETTVLRSGSTLQFGSVHVFKFVDPMFDQGGKRETAAMMRSRHKSGSVPETTFDLQGDVH
SGAPLPTSKVTHRYNHLYISDAISGEMERGMVKPMIRGEQQDNRSQDASVDRTELILPAG
IEFRDNSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSPSYRPDMSPSERTHKVI
AIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFVKQDRDLSRVTLDAQDVLAHLVQ
MAFKYLVHCLQADLNNYMPAFVDDPEEHNPQRPKIEDVLHTLTGAMSLLRRCRVNAALTI
QLFSQLFHFINMWLFNKLVTDTDSGLCCHYWGAILRQQLSHIEAWAEKQGLELAADCHLS
RIVQATTLLTMDKYSMQDVKNIHNTCFKLNSLQLHALMTNYHCAPDEPYIPPVSQK
Download sequence
Identical sequences G3NU64
69293.ENSGACP00000008882 ENSGACP00000008882 ENSGACP00000008882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]