SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000008945 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000008945
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-17
Family DBL homology domain (DH-domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 104-161,253-290
Classification Level Classification E-value
Superfamily PH domain-like 0.0000422
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000008945   Gene: ENSGACG00000006758   Transcript: ENSGACT00000008965
Sequence length 290
Comment pep:known_by_projection group:BROADS1:groupXV:3254420:3260631:-1 gene:ENSGACG00000006758 transcript:ENSGACT00000008965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLYGLMMKPIQRFPQFILLLQDMLKNTPAGHADRLPLQMALAELETLAEKLNEKKREAD
QRCEIRHIAKAMNERYLNKLLSNGSRYLIRSDDMVETVYNERGEVIKTKERRLFLLNDVL
MCATANVRCPDGSGNVPLDQKFLLKWSVPLSFVEVLEFGSSEDMADSSRYPASHSGEKVV
INAKPNKLYMGPGQLYQDLQNLIHDLSLVNQISSLIHSLKGNYQNVNSAVAQDWVSGLQR
LILKKEEEIRAADRCRIQLQLPGKHDKSGRPTYFSAVFNTLSPATKQSWI
Download sequence
Identical sequences G3NUC7
ENSGACP00000008945 69293.ENSGACP00000008945 ENSGACP00000008945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]