SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009014 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009014
Domain Number 1 Region: 962-1131,1183-1252,1320-1419
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.19e-116
Family Mammalian PLC 0.00000442
Further Details:      
 
Domain Number 2 Region: 1703-1807
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.79e-37
Family Ras-binding domain, RBD 0.0000089
Further Details:      
 
Domain Number 3 Region: 94-291,319-380
Classification Level Classification E-value
Superfamily Ras GEF 5.23e-36
Family Ras GEF 0.0048
Further Details:      
 
Domain Number 4 Region: 1445-1556
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-21
Family PLC-like (P variant) 0.0022
Further Details:      
 
Domain Number 5 Region: 1579-1681
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-21
Family Ras-binding domain, RBD 0.0002
Further Details:      
 
Domain Number 6 Region: 777-809,887-950
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000442
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000009014
Domain Number - Region: 427-469,504-577
Classification Level Classification E-value
Superfamily PH domain-like 0.000725
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009014   Gene: ENSGACG00000006801   Transcript: ENSGACT00000009034
Sequence length 1831
Comment pep:known_by_projection group:BROADS1:groupV:8865289:8892900:1 gene:ENSGACG00000006801 transcript:ENSGACT00000009034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVRACVRRTCCEQFYRACRQRTSVCSVLTGALLEATAALGSRSALPYLLPQSPSGHAVLK
ERQLASSMTSGGSLQPSASGVSKELAEVRHLVQFPEEIACILTGQEQELYQRVFPLDYLC
FLTRDVGSPESRTKRHHHLKASLSVPAIPTQSAQRSNAVEDLVARFNEVSSWVTWLILTA
GSMEEKREVFSYLVHVAKCCWNMGNYNGVMEFLAGLRSRKVLKMWQFMDPSDIETMRSLK
DAMAQHESSSEYKKVVTRALNIPGFKVVPFCGVFLKELSDALDGTASIISLKPPLYNTED
SIEFVSDYSGQHNFMSRSGPDGLHVPEKEATVSNILQIIRSCNRSLEAEDPDEASTDPSS
TCPASANNSFRDRCRNQFMVGDLSDSEGDLAPEPPSKDVEFRGTEETPRAFGHGTELIPW
YVLSLQPDVHQFLLQGATVIHYDQDSHLTARCLLRLQPDNATLTWGKRNERSSMYSVSCS
GTVNHWASPTEQPLGLGQAVVAGLAEGLLDLGVVKAVFLGHRGVDVHAVCLQNKLSQMTV
EENGLSLLYGLGTTDNRLLHFVAPNHTAQMLHKGLSELVNASRKLKRFPDQRLQWLRKQY
VSLYQEDGRYEGPTLPHAIELFGGRRWNMGTGGVEKSAAQKNSPLSINDKAKKKKKVLVR
GDSGDATDDEMVSRKTRSCKEGLYRNGLESDAIEQEDPEDSFPGPFALSTSKSPGLVASS
SSSSSSSSSSMAGPNHSRPQSSPILSGTAKSQPGAWSSRSWHGRGKSCFKGFQNLMISDS
TMSFIEFVELFKSFSIRSRKDLKELFDTYAVPCSRASPESAPLYTNLSIDDKDTGLQPDL
DLLTRNGSDLGLFIRTRQQMSDNQRQISDAIAAASIVTNGTGVENASLGVLGLAIPQLND
FLVNCQREHRSYDEILGIIQQFEPSSSMRQMGWMSFEGFARFLMDKENFASRNEESQMNP
EEMQYPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPVIY
HGHTLTTKIPFKDVVEAVSRSAFVNSDMPVILSIENHCSLPQQRKMAEIFKTVFGERLVT
RFLFESDFSDDPHLPSPLQLRGRILLKNKKLKAHQAPVDILKQKAHQLAHMHAQASNGSP
GVNSPGNHTNEEEEEDEDEYDYDYESLSDDNILDDKPEGKSSADKEEQSVDEIPKRMKKS
ESTTQSKGKVFDIELGEEFYLPQNKKESRQIAQELSDLVIYCQAVKFPGLSTMSPVGSAR
GKDRGKSRKSIFGTAPARCSATGEVVTQSRIPAKGGAERLSWEEHQTSPTLNPPTSLSAI
IRTPKCYHISSVNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSTNPNPLLYWLHG
VQLVALNYQTDDLPMQLNTAVFESNGGCGYVLKPAVLWDRSCPLYQQFCPMERDVEKMSP
AVYSLTIVSGQNVCPTNSAGSPCIEVDVLGVPIDSCHFRTKPIHRNTLNPMWSEHFQFIV
HFEDMCFLRLAVVENNSSQTTAQRTLPLKALKPGYRHVQLRTQHNEPLEVSSLFIYSRRI
EEVPTGGATPSSLLFSSEERRAPRQHRVTVYGAPGPELFTVFRITEQTTAKQLLDTVVAS
TGNPSDYFLCEEKVPLLKERSEAKRCSQHRPLAPEEEVVRLVSSWSSEEGYVGRICLKTR
DENLNDRNPSLEGEEEVAVGAEDDMFFVQVHEVSPEQPHTVIRAPRYSTAQDIIQQTLSK
AKYSFSILCNPNPFDYVLMEEVTKDTGSKKPSTAKPLQRVLLDHECVYQAQSRWRGAGRF
ILKLKEQIALNMVREDKKKVMSFASELKKLT
Download sequence
Identical sequences G3NUJ6
ENSGACP00000009014 ENSGACP00000009014 69293.ENSGACP00000009014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]