SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009078 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009078
Domain Number 1 Region: 2872-3037
Classification Level Classification E-value
Superfamily Cyclophilin-like 8.62e-66
Family Cyclophilin (peptidylprolyl isomerase) 0.000000916
Further Details:      
 
Domain Number 2 Region: 1169-1301
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-47
Family Ran-binding domain 0.000002
Further Details:      
 
Domain Number 3 Region: 2719-2848
Classification Level Classification E-value
Superfamily PH domain-like 9.72e-44
Family Ran-binding domain 0.0000386
Further Details:      
 
Domain Number 4 Region: 1815-1945
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-42
Family Ran-binding domain 0.00000376
Further Details:      
 
Domain Number 5 Region: 2111-2242
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-40
Family Ran-binding domain 0.0000285
Further Details:      
 
Domain Number 6 Region: 30-191
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000422
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 
Domain Number 7 Region: 1593-1620
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000000408
Family Ran binding protein zinc finger-like 0.0012
Further Details:      
 
Domain Number 8 Region: 1497-1524
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000162
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Domain Number 9 Region: 1554-1581
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000366
Family Ran binding protein zinc finger-like 0.0018
Further Details:      
 
Domain Number 10 Region: 1438-1463
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000785
Family Ran binding protein zinc finger-like 0.0027
Further Details:      
 
Domain Number 11 Region: 1332-1359
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000129
Family Ran binding protein zinc finger-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009078   Gene: ENSGACG00000006831   Transcript: ENSGACT00000009098
Sequence length 3037
Comment pep:novel group:BROADS1:groupXVI:13666342:13684382:1 gene:ENSGACG00000006831 transcript:ENSGACT00000009098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRSKAEVDRYVSSVQSSSPSLKEKPVKGFLFAKLYFEAKEYDLAKRHVSEYLKVQERDP
KAHKFLGQLYEREGDINKAVGCYKRSVDMNPAQRDLVLKVAELLVSKQECDSRAEFWVEK
AAKLLPGNPAVFNLKERLLSRQGQPGWNRLFDLFQVELAARPADAHVNVKLVQLFCQDGR
LDEAVKHCLAADKRGVLNHSLDWYRVVVRTLQDYLTQPSVSGNEKMYRDLQKELLLAHCS
LLRITLSESSIQPSLEALSGFDQAMQALSGIAGRHPDDLCEVFTEMRGHLYLHAGTLLLK
QAQNHQHTWRSVIDLTTLCYLLAYQTPRPKAKVTKRDQSSPQLLELLANDRQSQAGHMLL
NLTTAPASLIEEVVEVFGNPSGQESLLQLLFGPHVSIGPSFIANDDIHSIAVMVPEVSQL
VKWDAGSILLHAGDLQHLSWLGLQWTLLAQRPALRDWLQQLFPRLTLETSKLDTNTPESI
CLLDLEVFLHGVVFCSHCQLQETAKQQRQLYEPRCLPLPLLRLLTTDRQREWWEAVDSLI
HQRAAPSTSAKLRMIVQRGLSSLRAGEKHGLQPALAIQWARCLSQTCDGVNSFYDQKEYI
GRSVHYWKVVLPLLEKIKNRRSIPEPLEPLFMHFHSQDIQISSVKGHEEEYRIAYSVLLD
IEGKTEEAIATLETINNLSSVWHLAQIYQRLSEEASNGVEETQERCITFLRKFRNNLSKI
YNANADDVEKLPVSMEEVMDLLNDVNQQLGESGEAMDEEEEHGEGQRGPAYSSLATGSHI
KFSTPSPNKSLISPSKRHLISPKTPPHWVEDQKSLLQMLCQQVEALKNEVHDLRHNSSGI
ASSPRHKMYGESYGAEGLQEPFTPAQSYHGAPLTVATTASSAYYNPSPAYNSQHLLRTAP
NVTPTKGPMYNMNRMPPQQHMYAYQQPTHTPPLQTAPPCIYPPQEPGYGAPLRFESPATS
LLSPYSEEYYGQSVQSTNPPLPEPGYFTKPSVVQPPKSTEGKPLDFGKLSFSQQAPAEVP
KVPSFGAGAVAHSTPSSSFKFNSNFKSNDGDFTFPPSQAKHSESLLGLLTSDFPSRIDNA
PEKPAAKEQPHGQTSLFTFGNKNTPSFSFADSLPSTRTGSLFEKPDKPFTFGVEVPKPVF
DVPTSAAEEERAAESDNESTREEDEDGPHFEPIVPLPDKVDVKTGEEEEEEMFCNRAKLY
RFDADTREWKERGIGNVKILKHNGKGKVRLLMRREQVLKICANHYITADMLLKPNSGSDK
SWVWNAIDYADEEPKTEQLAIRFKTAEEASLFKVKFEEAQKVVVKSAKRQPEKKEENLKG
SELLAAQFARKDGEWDCNVCCVRNKPVDVRCVACQSANPNSSSKPDMPITSEAKPSPFTF
KFGTDSSKPSSTGSTFTGFGALGASVPSSFTFGTSASKPADTASAFGSGFGSQFSKKPGQ
WDCDVCEVRNEASADSCVSCKALKASSKTTAPIAPTTAAPSISAVGSGFGAQFAKKPGQW
DCNACEVRNEVSADRCVACGTPDPAAKSTAAPAATAASTLPAGSGFGAIFAKKDGQWDCS
DCLVRNDASAAECVSCHSPNPNPSIAAMFAMKDGEWDCDGCLVRNGTSADKCVACQTPNP
NAKSTTSTAPSSSTFSFSFGHKSSSSQPAGTGFKMPFDTANAFKFGQNKVQSSASSFKFE
TPQSGSSTTSSSGFSFLLPAAAGGFKFGIQDPAQETPSADDQVPPSGSASSFLRSIADKH
KEKEIVSTPSVDPTDFADLAESSEGKFKFGQNDPNFKGLSGTGESLFTIPTKAEATNELE
EDDMYKTEENDDIQFEPVVQMPDQVDLVTGEEDEQVLYSQRLKLFRFDLDTSQWKERGVG
ILKFLKNTSNGRLRVLMRREQVLKVCANHWITTTMNLKPLAGSDKAWIWLANDFSDGDAR
LEQLAAKFKTPELAEEFKEKFEECQRLLLDIPLQTPHKLVDSGRTARLIQKAEEMKSGLK
DLKFFLTDDKTKIKEDDGQGELTTKSHVSNLVVKPLGETPGPTLEWDNYDLREEALDDTA
DPSVYASPVASSPPRKNLFRFGESTGGFNFNFQPGISPLKSPAKLNQSGASVATDDEQDV
SQDEERDGVYFEPVVPLPDLVEISTGEENEQVVFSHRAKLYRYDKALGQWKERGIGDLKV
LQNFDTKRVRLIMRRDQVLKICANHRITAAMKLEPMKGAEKAWVWSALDFAEVVEGSMEQ
LAVRFKLQETASAFKQVFEEAKVAQENDKLMTEATSRVTTPQDGAPTPPSPAAMPVCGKA
AIAVLEETTKQRTELPPNAKPSTSSSQSPVNPSKTVVSPPKFVFGTQSLQKFFGSPKSHS
ETAESSSGFKDSERPGKASAAFKVPEKVLLHSLVSSASHCSSVILSQPKILSPSENLDVE
QQHEIKVVHDFKAVSPHNASVCVVSVSGPQAAGGGAGSGEDADVEVVYVREPTAEQADLA
RTLMLPLTFFCYQNEPGYASDDQTDDEDFEAAVKALNGKLYPDPPQKEAAACSDEPDCQV
VWEKKPTPVEEEKAKSLQLPPHFFCGLSTTDSDPDQDKPEDFETEVRKAHQDLSKIRMDA
FFSKSSGCYKTNTAPILKMRSEQQISDQPAETLSEAPSSSTTSPIDLSTKKSPEPESSAG
TLITSNISNFGFKALGGSSFADLAKTTDAYAFGGQDSNFSWANAGATVFGRGLSSVPKNE
GEEGSDEEDTSNTEDIHFEPIVSLPEVETKSGEEDEEILFKERAKLYRWDRDLGQWKERG
VGDLKILFHPTKRFYRVLMRREQVLRVCANHTITQAMELKPMNASANALIWTATDYSDGD
GTVEQLAAKFKTPEIAESFKKTFCECQSRTAQTEGDVSCVSSPQMSRVQEHSRDSNPLVF
LHVAADDQPLGSITMELFSHIVPKTAENFRALCTGEKGFGLKASVFHRVIPDFMCQGGDI
TNGDGTGGTSIYGSKFEDENFDVRHTGPGILSMANRGRDTNNSQFFITLKKAENLDFKHV
AFGWVRDGMDVVQQMGELGTKGGKPAKKLVITDCGQL
Download sequence
Identical sequences G3NUQ9
69293.ENSGACP00000009078 ENSGACP00000009078 ENSGACP00000009078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]