SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000009097 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000009097
Domain Number 1 Region: 4449-4575
Classification Level Classification E-value
Superfamily Nucleotidyltransferase substrate binding subunit/domain 3.41e-22
Family HEPN domain 0.0044
Further Details:      
 
Domain Number 2 Region: 91-288
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.27e-21
Family Heat shock protein 90, HSP90, N-terminal domain 0.065
Further Details:      
 
Domain Number 3 Region: 1453-1638
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.86e-16
Family Heat shock protein 90, HSP90, N-terminal domain 0.057
Further Details:      
 
Domain Number 4 Region: 2523-2648
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.02e-16
Family Heat shock protein 90, HSP90, N-terminal domain 0.056
Further Details:      
 
Domain Number 5 Region: 4303-4367
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.00000000798
Family Chaperone J-domain 0.0000719
Further Details:      
 
Domain Number 6 Region: 11-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000198
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000009097   Gene: ENSGACG00000006866   Transcript: ENSGACT00000009117
Sequence length 4579
Comment pep:known_by_projection group:BROADS1:groupI:4139700:4159247:-1 gene:ENSGACG00000006866 transcript:ENSGACT00000009117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHLKNGFMLPRVTVRHEYIGLRSYRVSPFTSVEDIKELLYEETNLPVKEQRLTHNGRLLD
DSVQIRTLVPAGSPEVSVALEGSGLKGGGRFGQTTPPLVDFLKDILRRYPEGGQILKELI
QNAEDAGATEVKFMYDETEYGVESLWSPDMAQYQGTALYVYNDAVFTEEDWNGIQEIARS
RKREDPLKVGRFGIGFNSVYHITDAPSIFSGDQIAMLDPHQTLFGVHESGQCWNLKTDMK
EITELADQFTPYFGIFGSSEKTVKDGSFPGTLFRFPLRLKPSQLSGNIYNKEKVLELFES
FKADADTVLLFLKSVQKISLHVRECDGTERMLFQVTATENTEDKEERPNALNTLGEAIDG
YGNGVPSSTITCVTYQVSIETQDETAKETQRMTWLVCNGVGGRGMCPELDSLADVLKFMP
TIGIALPLTVVNKGDTGATSGFSGRAFCFLPLPPGEESETGLPVHLSGFFGLTDNRRSIK
WREVDQWRDPAALWNELLIITVIPWAYFTLITEAIRRVQTQQDQDFPLSPAGTYGAWPDP
KRVKSRWKPILQPLFHDLLQQQVIHSLSESWIRVDQAVFSELNTDEDISETVISYLQSSG
TQVAKVPAATDFVFAACTTESIEVRKVTPSLLRQVIRKCKHKGPSQEKLLLLEFALSDGN
YSDLIGLELLPLQDGTFTTFSSSFSDKDSIYIASEQYPKSLYPGLEGRFLLESIKPLVMD
ALKEAAKSRGRPCTQLQMLNSERSARLIKEILSTAWLSRDFIVRWEPGNKELKHPTVSWL
KRIWKHLYIHFADDLSTFEDMPLIPLVPLEESMEVAQLLRLKTPSPVILLDEEESSLPEN
LVDIMEKLGGVVIKKLDSSLQHPQLKNFVHPSSPGLLLQIMDRLPTQRLSGLVSSFSVKE
KVALRNFLAGLSDITAREKHTLLELSIFEKVGTCSEGTSAFTSLRGARALHHRAKYPPDV
KLSINLVGCCDEESIRLIKMLNVQQLKTTECLKMIIQDIERGFYTTDEVTQVMLWALKHL
AFLKNENPTVIRWLSALTFIQLPCGKSVKASDLFDSELEILQNLFYMEEKSRFPPGLFKS
SADILHSLRQLGLRNEVELTEKDVLKVAMKIEELQSSREPEMELIVKKAKTLLQILNRQT
KLVKSADAQMSLLKLKWVPVCKERPLTYPKSLAWVGDDLNICSLSEMCDISHAVLVGSSV
ALVEHTSAGMKKALKLTTEPQVDQVLQQLKAVNDWHKSQAFTTEDWYQFQQILFEIYGFM
QAHLEDAREAMKSLPFDWVWTGKTFSSPGHTALKPLPDLDLQPYLYTLPKTIRKFHKLFK
FCGSVEEVVSSHVFEVISTIKQRCDGEITKEESKHDILLLVNILRWLNNNQIEVDTDMHV
PILCYKDPSKLALKPIHECTYCDIKVDDLNDLLEDASEPIILVHDDIPMKTAEWLKVPCL
STRLINPENLGFEQSGQREPLTVRIKNILEEYPSVADIFKELLQNADDASATECSFLIDM
RKNTNIRENLLDPGMIVCHGPSLWSFNSSVFSDADFLNITRLGGSVKRCEADKVGKFGLG
FNSVYHITDIPIIMSREFMIMFDPNINHISKHIRDSSNPGIKINWSKQQKRLRKFPNQFK
PFINVFNCQLPLAEDSPYKYNGTLFRLPFRTEQEASASEISSLYYNTTDIYSLVDEFSIC
GHRFILFTQHVGSMVLKYLKYEEPNPAGAQDVVTINKSVWSSKSSYGPLSILKSAAKVMK
KVASTNRVPADVPKSGCIIRVLVEEFHNVFKRIVDLHSPLFRGSEEDPNQYFEMAAKGIQ
TRRLTDEMSAKAVEVTNWLICSCMDVTEALKFSLSDSGKRLGLVPCGGVAVLLSEEENRK
WTVKTNATPIGEVFCYLPLRIKTGLPVHINGCFAVTSNRKEIWKTDTKGQWNSVFMRHVI
VQGYLAALTMLRSMAESGELLDYSYYAAWPDPSQVHDDFTLVSQGVYQEIAKGGDGEHAN
VFSDGKTWVSIKYVRFLDDALLCRPDIGPAAFKIFLKYLKKSGSQNLCAVELPDWVKEGF
DDAGCKGKLMENTLTEKQFFSDVFFPHIEEIDRELRDPLVHYVLNEKLEDFASILRVTPC
IPCCGPKKELVLPSRLIHPEGRVAKLYHTDDGRFPEGTTKDYLNPVCLVKLVQLGMVKDD
LSWEDLIERAQSVIDLNEKDHTAACFRSSIVLSLIDEKLKMSDPGPAELLEKLHDTKFLP
FLTRPAGFSLPWHGNNFPPTKMFSAKDLFTTEHQETVCLMMPILNENSPSFKGCGAMSLA
VKDCLGLIRKPSVGLVISQLKKLSQSFDGVTLYQENITNACYKFLHEEMLQDKKATEQIS
EELKEFNSILVENTYVNPSKVAFHLNFDAAPHLYQLPNKYRNSCRELFENVGVQASFTVE
DFATVLETVKEECGRRVLTEENFQLCRRIISEGIWSLIRDKNQEYCQAHFGGILLPDFNL
TLQPSKSLCYNDCPWIKVRDSSVKYCHGDIPREVAVKLGAVPKRHKALERYASNVCFTTL
GTEFGQKEKLTSRIKSILNAYPSEKEMLKELLQNADDAKATEIYFVFDPRTHPTDRIFDD
KWIPMQGPALCVYNNQPFTEDDVRGIQNLGRGTKEANPGKTGQYGIGFNSVYHITDCPSF
ISNNDILCIFDPHAQYSPGATSTSPGRMFRDLDSDFRSQFSDVLSLYLGVHFKLERSTMF
RFPIRSKGMAKISEISSVPASDRMVQNLLDKLKTDGAELLMFLNHMEKISICEIDSASGA
LKVLYSVTAKITDGDRLKRKQFHASVIDSVTKKKQLTAIPVQQITYTMDIEDNDGNLTSW
MICNRSGFPDIENVSKSVISAHKNEDITLFPRGGVAACVSHNYKKPHRAFCFLPLSLETG
LPFHVNGHFALDSARRNLWRDDNGVGVRSDWNNNLMTSLIAPAIVELLIQLKRRSFQGPD
PTITVLQGTPLHVVKDTLRKYLFFFPVNRVDIQPDWYCLVKAVYNCIHADMKRLLPVVRA
VHMENSDMHSVIYISWVNTSTANKGRAFFDNLLQDELEHLKNTEYNITSRKSVAENVYRL
KTLLLDIGFNLVHSCDETANLYFCLEDAGIPVSYVTPDDVRHFLHTFLSPDTSCHVGKLP
CRIQQSNFKLVHNLKLLVDYCFKDREAGDLTIEGLPLLITMDNMLQVFDSKRPKFLTTHH
ELISSRKEMFMNTLYIRYSNILLMAGAAKTFDISCFADLLGSVLPREYRTRIPVKWRDTF
ASESWLKSVWNFISENIAVKEDQVDIKPSFETLLDILKDWALLPGMKFMARDKIVVPEHD
VLLPLSLMSIAIFPHGQNDKVFHTLMKAGCIQLAVTKICLKDNPIMPFLAQHTANIENPS
SVLKAVEYIIQTATFKTSNLTEKDFEALLLYFNCNLANLTKQDAQSLKLLPCFKSVSGRY
ISIANNGTNYVLVKSIPTADIDKWAHTAPLGFLADNQQLKDLYTFLGCVPIDDLEIYLQY
LLPKFESLSYDAKVEHIVYLKERLLSMEESCEMKNQLYEKLEGLLFIYDYSNRLRPTKFF
YDETVKVFKVMLPTKSFIQSDFFKKVEQVSKPRNGTLLLTSWITFLRNIGLKHKVSQQQV
LQFAKEVSIKAQTESWSQEKVQTIVDVLLNHIFNDRTDLLEGTFLKELSMIPFLCPERAP
NELIKLHSQYQEMSGTIPLIRFSGSQVNPKFKQTDVIHLLWTSCPILPEKATPSSIKDQE
GNTLTGQEQLDHVLNMLGVNLDPPLEKVLSNCKNICNISNPDDEMVKTRNKVLRSTYEFL
NADKRDFRYQLRGVAVVMVEDGWKLLKPEEVVINLENESDFKPYLYKLPLELGTFHQLFK
LLGTEDVVSTKQYVEVLWRIYKSSDGKQLDPNEMRTVKRVVSGLFKSLQNDPVAIRNDLE
SLKDLLFYMPSHDGRLAKSSSLVFDDAPHYKSRIQGNVGVQMLVDMSQCYLGKDHAFHTK
LIMLLPQKLRPRLLSSILEEQLDEDSPRMCQFGALCSLQGRLQLLLSSEQFITGLIRIMK
HENDNAYLVNEEKAIRLCKALCEGLKVSCFEKLQTTLRVKGCSPIPHSRSETLAFLKRYG
TAVIHLYIQHSDSKDINFLLALAMTLKSATDNLISDTSYLIAMLGCNDIYRITEKLDNLG
VKYDSTEPSKLELPLPGTPIPAEIHHTLLMDPMNVFYPGEYVGYLVDSEGGDIYGSYQPT
YTYAIIVQEVEREEEENKSFLGKCFQIDIGYSEYKIVSSLDLYKFSRQDESNHVRETSAP
STPTSPNSRSSGPRMASAAFSGKENLRPPAQKQSPKKIKLHTLPEILKEVTLVVEQAWKL
SETERKKIIRRLYLKWHPDKNAENLDIATEVFKHLQNEINRMEKQTLADQQNTERASRRS
FSTSSSRFQSEKFSYQRFYSSWNQEATNHKSERQQFREHYTSYAGSSHSHRFFVPPTFKT
VGNPVEARRWLRQARANYSAARNDLHKNANEWVCFKCYLATKLALIAADYAVRGKSDKDV
KPTALAQKVEEYNPQLKGLSKDVQILEGYGVDSLRTRYPDLLPFPQIPNDRYTSEVAMRV
MECTARIIIKLETFVQQKI
Download sequence
Identical sequences G3NUS8
ENSGACP00000009097 69293.ENSGACP00000009097 ENSGACP00000009097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]